SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 67593.JGI144400 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  67593.JGI144400
Domain Number 1 Region: 406-535,585-646
Classification Level Classification E-value
Superfamily cAMP-binding domain-like 3.11e-40
Family cAMP-binding domain 0.00051
Further Details:      
 
Domain Number 2 Region: 177-400
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 8.24e-17
Family Voltage-gated potassium channels 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 67593.JGI144400
Sequence length 971
Comment (Phytophthora sojae)
Sequence
MAARQGGHMLAGVAAAAMANSRTQSPSPSSSPANRSPAVPRLAAVARGVAPRKSVMSRFT
QFSKPVSVVPYAPERLSITQSAMNPEMVKTMKDKGLPQPRKEGSVATLFAALRMRRVLHR
VQAEHEEQSGPRAIVDETEANLERHLKVLSRYKIRQVDTDGDEGRYLRNLPPLMVNPHST
LFKIWQLITLIIIIYQSIMLPFNLAFGSNDTTAIDILMSSIFALDIVIAFNTPVAEDTDE
TGYIMNRWHIAAIYLRGWFFFDLLACMPFDYVLLLVNNSKSNLSVLGLLKALRVPRLLRL
YSRHANLLRLVRLVVSFLVINHYVACFWFGLIMSEQTRALDPSTDSLHLYIVALYSTLLV
VMGQNITVYEETEYLFCILAMVVGAVLMAVVFGNVAILIANYYEAQSSHQKKMEWLFASM
NRMKLPYDLQNRINAYYQAMWERHGTLDGAVTAFIPELSRNLAYEVELFLRMDMINRAPI
FQNCSAKVVQELVMELELQVFMPGDYIVVRGEVGNDMYFVQNGICEVTKEIELPPVSMPR
NPSRLSQASQAAQAALHFRGSHSTRESNSSHTLPQPVSQGPIKSKEVVLKILGPGDYFGE
IALLMNCKRTANVRAQVFSELCTLTREVFESISQRYLEDRNIIEKFIMDKYDPSMLQAAM
KQSQEVSMRGTGAAAAAAASRTTVFPRSNAPGSPAASHAMSFGEGVSRGETATAKITGLL
TKVLDRIDHLEDQLGKEAEARRESDTKLRMSLHEAARRLSVNSRSPGSSMAEPRALPRHP
AALSRHAGKSVADEPERVSQRNLRVAEHLAELEAKEAQSKSPDKPAEAAKPAVTEAASSP
EELKLNNRALKALRSWRNIRRDNLGLGMRLRSSSKTHLGQQGYTPGIGVGIGVGGAGSSF
RPGSGATSARRHSSTRSVSRAHDTIGGDSALLNPEPELRAGEEEEKEEITDQFPSGMLDD
LANKLDPSSKS
Download sequence
Identical sequences jgi|Physo1_1|144400|estExt_fgenesh1_pg.C_1850007 67593.JGI144400

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]