SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 688245.CtCNB1_0479 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  688245.CtCNB1_0479
Domain Number 1 Region: 167-355
Classification Level Classification E-value
Superfamily Methylesterase CheB, C-terminal domain 6.41e-72
Family Methylesterase CheB, C-terminal domain 0.000000298
Further Details:      
 
Domain Number 2 Region: 2-103
Classification Level Classification E-value
Superfamily CheY-like 3.42e-25
Family CheY-related 0.0000201
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 688245.CtCNB1_0479
Sequence length 364
Comment (Comamonas testosteroni CNB 1)
Sequence
MIVVDDSALVRSLLAEIINRQHDMECIGSANDPLIAREMIRDLNPDVITLDVEMPRMDGI
DFLGRLMRLRPMPVVMISTLTERGAEVTMRALELGAIDFVAKPRVGVANGLQELASQIVD
KIRVAAVAQVHRLPVVPHGVAAAASAGAKPAAPRAPAAPSLLGRISTEKIIAIGASTGGT
EAIREVLTHLPADCPAIVITQHMPPGFTTSFAARLNSLCQMTVKEATHGERLLPGHAYIA
PGGKHFSITRSGANYVAVVDDAPPVNRHKPSVEVLFKSVAASAGRNAYGIMLTGMGADGA
TAMREMRDAGSYNLVQDESTCIVFGMPREAIVHGAADEVLPLPQIAHALLSKLRGGSDQV
HHRI
Download sequence
Identical sequences D0IYI9
WP_012836881.1.54103 688245.CtCNB1_0479 gi|264676615|ref|YP_003276521.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]