SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 69293.ENSGACP00000003307 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  69293.ENSGACP00000003307
Domain Number 1 Region: 503-704
Classification Level Classification E-value
Superfamily RNI-like 6.47e-16
Family 28-residue LRR 0.019
Further Details:      
 
Weak hits

Sequence:  69293.ENSGACP00000003307
Domain Number - Region: 38-73,307-319
Classification Level Classification E-value
Superfamily PH domain-like 0.00173
Family Pleckstrin-homology domain (PH domain) 0.027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 69293.ENSGACP00000003307
Sequence length 714
Comment (Gasterosteus aculeatus)
Sequence
HPLAFSSLSLPSQPTGYMETSLSYSFIEDLQLLSWDNAPKYCVQLSFPGGTVLLQAANSY
LRDQWFHSLQWKKKIYKYRKVLNNPSRWDVVLKEIRALVDMALTSPLQDESIYQAPLHII
STLLAENSNLSTQDHENIIVAIAPLLENNHPPPDLCEFFCKHCRERPRSMVVIEVFTPVV
QRILKHNMDFGKCPRLRLFTQEYILALNELNAGMEVVKKFVHSMHGPTGQCPHPRVLPNL
VAVCLAAIYSCYEEFINRSVIGTLPSLKEIRNGCQQQNERKPPMPLRCCAPSRRRRRLRT
PSSTPPTLSHQPRRPRTPPRPSPSPPPLLLPPPCVVTSSEILVELERNNNSANARRKDGP
AAVEREPNLIDRLLVSPAASTLSIQLPAQADRVLGCFALILKMLSDYDDWRPALASLLQP
IPFPKEALAHAKFTKELKYVIQRFAEDPRQEVHSCLLSVRSGKDGWFQLYSPGGVACDDD
GELFASMVHILMGSCYKTKKFLLSLAENKLGPCMLLALRGNQTMVEILCLMLEYNIIENK
DTQLQIISTLESTQVGLRMYEQLCDRQRELKELQRKGGPTRLTLPSKSTDADLARLLSSG
SFGNLENLSLAFTNVTSACAEQLIKLPSLKQLNLWSTQFGDAGLRLLSEHLACLQVLNLC
ETPVTDAGLLALSSMKSLCSLNMNSTKLTADTYQDLKAKLPNLKDVDVRYTEAW
Download sequence
Identical sequences G3NDA7
69293.ENSGACP00000003307 ENSGACP00000003307 ENSGACP00000003307

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]