SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 69293.ENSGACP00000006405 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  69293.ENSGACP00000006405
Domain Number 1 Region: 538-622
Classification Level Classification E-value
Superfamily Kix domain of CBP (creb binding protein) 1.57e-36
Family Kix domain of CBP (creb binding protein) 0.00000626
Further Details:      
 
Domain Number 2 Region: 1029-1147
Classification Level Classification E-value
Superfamily Bromodomain 1.15e-33
Family Bromodomain 0.000000694
Further Details:      
 
Domain Number 3 Region: 302-394
Classification Level Classification E-value
Superfamily TAZ domain 4.97e-29
Family TAZ domain 0.00000132
Further Details:      
 
Domain Number 4 Region: 2024-2080
Classification Level Classification E-value
Superfamily Nuclear receptor coactivator interlocking domain 6.28e-26
Family Nuclear receptor coactivator interlocking domain 0.00025
Further Details:      
 
Domain Number 5 Region: 1714-1798
Classification Level Classification E-value
Superfamily TAZ domain 4.32e-24
Family TAZ domain 0.00000234
Further Details:      
 
Domain Number 6 Region: 1650-1696
Classification Level Classification E-value
Superfamily RING/U-box 0.00000000002
Family ZZ domain 0.0002
Further Details:      
 
Weak hits

Sequence:  69293.ENSGACP00000006405
Domain Number - Region: 1227-1268
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.000806
Family PHD domain 0.052
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 69293.ENSGACP00000006405
Sequence length 2344
Comment (Gasterosteus aculeatus)
Sequence
MAENVLDHGPPSAKRPKLSSPALSASASDGNDFGSLFDLEHDLPDELISANESGLVNGGD
LSQDAVAKHKQLSELLRSGAPTSAQQGHQGAMGGPGGPSAMGQHLANMKASPGQGPPQMM
VQGQQQHLSPQQQVNMMQQNASAGMMGGLNRAMMGAQQKGNNGQQQPGMIGSQVMNGSPR
MGFGNQGMGGNSNLLAETLQQQGAGGQAGMRGQQPGAMNKMGMMGNPGGPFGGPYTGQGN
QGLGGAGLGPQLQNKSPLGNSLAQFNVDKKNQPMQGMAAMGGLVGARAQVSAASAAAGAP
PTADPEKRKLIQQQLVLLLHAHKCQRREQANGEVRQCNLPHCRTMKNVLNHMTHCQAGKS
CQVPHCASSRQIISHWKNCTRHDCPVCLPLKNAGDKRNPQSLLSAAAAGLGSSLGSVPGG
QPSTPNLNPPSQIDPSSIERAYAALGLTYQGNQIQSPTAQPSMSNQGLQGPAGMRPLNPM
GANPMGVNGGVGASPQSQQASLLQDTMMHLNVNSQGLLNDASGVGSMPTAGPPSSSGMRK
TWHEDITQDLRNHLVHKLVQAIFPTPDPAALKDRRMENLVAYARKVEGDMYESANSRAEY
YHLLAEKIYKIQKELEEKRRTRLQKQGLGLGPAGMGQSPTGLPPNGPLSDPSMVRPPGPN
QMVNRMQGPGMNQFNQMGMQSMGQRSTPPLPMGGFPLFPLKIDIQNPPGQKSAIADIAMA
GPRMGQPNVNQLQNQYLSQGQFPGSGAGTPQPGMAQPGAPTGMPQTQMGTPPSLPVASPL
AQPGSAGGPSGVPSVGPMGPQSVGGGGPNSVGGPPASSMTPPNANQQPNSIPHLAAMRGS
PSPAHSRSPTPHQTPPRLAGSQTPQPHTPNAPQLGPPSAPPQSQLGQGSTPHGSQLPRTP
LSQKGSFPADSQAHTPASVSSLDTSSQQPQSNASTANLDPKMEVKQQDDEDESDSGSCSK
GGKLSNLKTEEKPVKLEVKKEECYDEGGKGVSMDTSTAMPTAKIKTEDRKLEIKKEEDDT
SDSSSTQASVKKKIFKPEELRQALMPTLESLYRQDPESLPFRMPVDPQMLCIPDYFDIVK
NPMDLSTIKRKLDTGQYQDPWQYVDDIWVMFNNAWLYNRKTSRVYKYCSKLAEVFEQEID
PVMQSLGYCCGRKLEFSPQTLCCYGKQLCTIPRDAAYFSYQNRYHFCEKCFNEIQGDTVS
LGDDPTQPQTSINKEQFEKKKNDSLDPELLVECLDCGRRMHQICVLHHETIWPSGFVCDG
CLKKTNKTRKENKYSAKRLPQTKLGSYLEMRVNDFLKRQTHTGAGEVFIRVVHVSDKVVE
VKPGMKSRFVDSGEMSESFPYRTKALFAFEDIDGSDVCFFGMHVQEYGSDCPQPNQRRVY
ISYLDSVHFFRPRGLRTAVYHEVLIGYLEYVRKLGYTTGHIWACPPSEGDDYIFHCHPAD
QKIPKPKRLQEWYRRMLDKAVAERIVHDYKDVFKQATEDRLTSAKELPYFEGDFWPNVLE
ESIKELEQEEEERKREENSTSNESIDETKGDSKNAKKKNNKKTSKNKSSLSRANKKKPGM
PNVSNDLSQKLYATMEKHKEVFFVIRLIAAPMANALPPITDPDPLMACDLMDGRDAFLTL
ARDKHLEFSSLRRSLWSSMCMLVELHNQSQDRFVYTCNECKHHVETRFHCTVCEDYDLCI
TCYNTKGHIHKMEKLGLGLDDESSNQSTATTQSPGDSRRLSIQRCIQSLVHACQCRNANC
SLPSCQKMKRVVQHTKSCKRKTNGGCPICKQLIALCCYHAKHCQENKCPVPFCLNIKHKL
RQQQLQHRLQQAQMLRRRMASMQRAGQAAPGGAPGGNGLPSPGGNNGATAPGTPTSVGTQ
PATPQTPTQGNMPALAQQQGVGMGSLGKPGMGPATPPQQQQPNQGQGPMPVQGQQQGPPQ
AAVETALKIQRLAETQRQMAQIQAQAQIRGPGQGGMIPSHHQNTQAQMGMAHQAQGVVGR
TMLDPQQQQQMTQQQQQQPGNRGLMQVMGGSAGAPNSIAAAAASGNLPQAALQDLLRTLR
SPSSPLQQQQVLNILRSNPTLMAAFIRQRAARYQGGQGGPGGAVGPPQGGLGGVRFQGAP
GVLPGAGGPGANQLASIDGQQQVNVSQPGMNMAQGGAGGGNMPTMAQLQQAMQVGQQGNI
TSMTPQLRDLFMKRQLQLGNHGQFQQPQGLQQQQGFMQPGQGQPGVAPSSQPQLGGGGVR
GPPQQGGPQRPPLQSGQGGPQQQGNVGGGGSGGGPSLPQTSQGMLHQNIHQRLLLQQQQQ
HLGGGSPGQHSSPMSPQQQMAQSPHPHMQGQGGLGPAGSLSSQVRCQHHPSMAPPQPPQQ
QQQP
Download sequence
Identical sequences G3NM42
69293.ENSGACP00000006405 ENSGACP00000006405 ENSGACP00000006405

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]