SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 69293.ENSGACP00000007857 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  69293.ENSGACP00000007857
Domain Number 1 Region: 9-112
Classification Level Classification E-value
Superfamily Ubiquitin-like 1.62e-24
Family Ras-binding domain, RBD 0.0047
Further Details:      
 
Domain Number 2 Region: 922-1011
Classification Level Classification E-value
Superfamily PDZ domain-like 4.99e-23
Family PDZ domain 0.0011
Further Details:      
 
Domain Number 3 Region: 195-300
Classification Level Classification E-value
Superfamily SMAD/FHA domain 0.0000000000000678
Family FHA domain 0.0062
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 69293.ENSGACP00000007857
Sequence length 1022
Comment (Gasterosteus aculeatus)
Sequence
ADDPSELSNQITAPGILKIFGNEICEGAHYKSVLATTHSSGKELVKEALERYGLDKEEAE
SYVMCDTIGSTRDHRWRTEGFRVVSDNEKPLILQSLWKPKKGLARRFEIQRRSLIEEKTS
NDKDTVTAGINAQARKLQKSRSRGNSGSQPKTEGLCPPTLRDEREGEESEESEREATESS
NDNTILYSIHPPHDCPYLLSLQAFSPAQDFVIYLLIGPNIAFGRQSDHDNCTKPDTLLFA
PDILPRHCHFQRHCVGGPTVLRPSPNATLTRNGEALRKEVQLMPGDIIGMGQSYLFLFKD
PLASAHKVRVGRKRDRPTVTCATYSLSSFLSVYESKDEERIVKEIVAMGRTSEKDGPPLT
VAFLLCRCMQYSSTCLHSSDLRRLLLLIANRVQSAVWEDTKCLAVVQSEVSEGSNPEDLQ
ALGQPEAILGLRPLAVWMSNSLELLQFIQCQLPLILKWRTRKEKGQEVEEGGMENDQNKG
RENLALLALRLSSVRTASEETMAVLEDVIMLAFQQCVYYITKILYPVLPALLDSNPFRVP
GSGLRVPGEIQHLADVLTETWRLLRDCQLPPEISSQLVGYLFYFINASLFNLLMERGTNK
CTFHWWARGVRMRANLDLLLDWAHAAGLGELASEHTHTLSSAINLLATPRKNLLQTSWVS
LRSEYPALSPAQLNHLLSLYSPASPSICRHTWTPSVQDRAAANQTADILESFDTHHPLVL
PDEGYHFLLGRQITDVSLREQLDKLKEYMAFSDLQSDKVAATEEASLHMANKLPAKTNSS
QGGVCDRSPSTTSGALPPSASPPSSPSSTQNPDQFTSCDVLLLSRKLIDLELEGREAGDA
NRSAQDPSCLLTPPNNPRHVDPVEKWMKGDSETLPWSSSVNAHDEGRTTSPFMFVCGGLV
FECLAALEVDCSKLDSHSVKRFVNVFSLELERGEQGLGLTLVDTRDSSTRAKGVFVRAVV
PDSPAARCARLVPGDRILAVNGVSLLGLDFLSGKELIQSSGDSLRLLVARSDWMAATIRT
DC
Download sequence
Identical sequences G3NR90
ENSGACP00000007857 69293.ENSGACP00000007857 ENSGACP00000007857

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]