SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 69293.ENSGACP00000010141 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  69293.ENSGACP00000010141
Domain Number 1 Region: 66-190
Classification Level Classification E-value
Superfamily PH domain-like 9.84e-41
Family Phosphotyrosine-binding domain (PTB) 0.00041
Further Details:      
 
Domain Number 2 Region: 458-535
Classification Level Classification E-value
Superfamily SH3-domain 1.44e-18
Family SH3-domain 0.0004
Further Details:      
 
Weak hits

Sequence:  69293.ENSGACP00000010141
Domain Number - Region: 552-607
Classification Level Classification E-value
Superfamily SAM/Pointed domain 0.000538
Family Pointed domain 0.031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 69293.ENSGACP00000010141
Sequence length 624
Comment (Gasterosteus aculeatus)
Sequence
MFGNGTHFSFSPRGFSPEDLPPQRRAFQQDDLNVAPLQRNNMSRPSGKSIYMQRKEYSEV
LDRHPDNFHVRVEHLITCKLDGQEVKTVDDCLAKLKRLDAKGRLWPQEMGMEIQGGYLLL
SDIETKSELESLPLRSILETKAVLDSCAYNSLLILTVQERGRRVPQVFMFQCEETGADLI
KADLENIIGQQVSGSFRQAGPRPVQRERSPPPLDQPAAGWRSREPGGLPQGQWRRSLQVE
NVPPPPYVGSQEAEMYRPGLRGSYIDPEAAEQMEIERNTDILNHILNDVEFFMDKVSAAN
ETSLPEVKKKKKKKSKKNEAPAIILPPWEEYVSFLQRVKYGFNLLAQLDGCLSGPTAPDY
VHIFFDSLGAILPRYPADLPPTVLSPLLTEAALQLMCEVVSPEEDLLWRSLGDSWNIPGS
RWPDDDVPPYIPEFYNGWQPPPPSSMPSPLPYQSGPSSTSSSQHFPSSPREPPLYMQVIY
DFVAKNSQELSVMKGDVVQVVQKSKQWWLVRNGGGEEGHIPQNVLEPMQSRGPMEDLPRD
SRRPVTLDMNSSSTEVKAWLEHKGFSRITVSSLGVLTGNLLLGMTKDEIRTVCPEEGGKV
FFQLQGIKSAIALASEPSGLYGRY
Download sequence
Identical sequences G3NXS1
ENSGACP00000010141 69293.ENSGACP00000010141 ENSGACP00000010141

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]