SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 69293.ENSGACP00000013462 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  69293.ENSGACP00000013462
Domain Number 1 Region: 3-209
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 4.45e-53
Family DBL homology domain (DH-domain) 0.00027
Further Details:      
 
Domain Number 2 Region: 199-319
Classification Level Classification E-value
Superfamily PH domain-like 6.68e-25
Family Pleckstrin-homology domain (PH domain) 0.015
Further Details:      
 
Domain Number 3 Region: 372-547
Classification Level Classification E-value
Superfamily PH domain-like 4.06e-21
Family Pleckstrin-homology domain (PH domain) 0.0001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 69293.ENSGACP00000013462
Sequence length 549
Comment (Gasterosteus aculeatus)
Sequence
KKSKIHHIATEIMSSESVFVDVLKLLHVDFRDTVSAASRQSGKPVIEERLLNQILYNLPQ
LYELNYDLLRELKQRVAKWDENAQLADIFLKKGPYLKMYSTYIREFDKNVALLDEQSKKN
PAFGAVVREFEASPRCANLALKHYLLKPVQRIPQYRLLLTDYLKNLSEDSVDYKDTEAAL
EIVKAVANHANDTMKQGHNFQKLIQVQCSLSGHHEIVQPGRIFLKEGSLKKLSRKVMQPR
MFFLFNDTLLYTTPVQSSQYKLKSMLSLAGMKVSKPSQEAYQNELNIESVERSFILSASS
ASERDEWLEAISTAITDYTKKKISFISGKPSEVELEDLDDGTPLGSKAPIWIPDLRATMC
MICTCEFTLTWRRHHCRACGKVVCQSCSANKCCLEYLKNQLGRVCDQCFPILQLQKSVQA
ESAALSPGNRATFAFPRKPKKIPAALKEVTASTDNSSMSGYLQRSKSSKKQGKRLWFVIK
DKVLYTYAASEDVAALESQPLLGFELKVDSSHKLEFKLYHKNTLHYIFKADDIQTEQRWI
DSFKEATVL
Download sequence
Identical sequences G3P788
ENSGACP00000013462 ENSGACP00000013462 69293.ENSGACP00000013462

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]