SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 69293.ENSGACP00000017351 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  69293.ENSGACP00000017351
Domain Number 1 Region: 27-458
Classification Level Classification E-value
Superfamily Ras GEF 2.35e-99
Family Ras GEF 0.00023
Further Details:      
 
Domain Number 2 Region: 551-637
Classification Level Classification E-value
Superfamily Ubiquitin-like 2.27e-28
Family Ras-binding domain, RBD 0.0002
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 69293.ENSGACP00000017351
Sequence length 671
Comment (Gasterosteus aculeatus)
Sequence
TVVEEQDDGVIYTVVVKQQHGAPTSPASVSRSQCVKAGTEEKLVLHLLHSFSMGDSSFIT
IFLSTYRSFTSTGRVLDILTDRWESVLSVIQENIVRDLKAVCTVFSTWLSEYPEDFKSLE
EPSRLLRLVPLLPQDSSSAADLSARILRIAEALSEKALLPDARKDHTGPTGPPPDASKFE
PTSVLGFPAALIAEQLTRLETELFVRLVPYHCLGSLWSQRDKKGREGVCWSVRATIRQFN
KLANAVLASCLWPTGLRSQQRARLLEKWISVAEECRARKNFSSLYAIVSALQSNPIHRLR
KTWQDTDREAVRRYEELSEIFSDKDNYSQSRELLKEVSFRPSVISMLKKENYSHRGTNAQ
GTVPYLGIFLTDLTMLDTAVKDRLDNGYINFDKRRREFEVLAQIRLLQSSCKNCVFTTDE
AFARWYQSVPLLTEAESYRLSNEIEAPGEPSPRGVPPTVIITQCPNLSTSRNSLTGDSDS
LFDFPSPVNNLLSKLTKHMKSPSVSCLDVDTSSSTNDSTPAALTPSTPTKSHRRSISCGN
NPPNNIQGSGPEMRIIRIRMDLQDGNLYRSILVTSNDKSPTVISSALEKHNQDPKQTSRY
ELIQLLPEGKAELVIPATGNVFYAMSSSSVDFLLRRKGGIAPPGSQPINTETSATFPRIK
AKGRRLVRTLF
Download sequence
Identical sequences G3PIC4
ENSGACP00000017351 ENSGACP00000017351 69293.ENSGACP00000017351

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]