SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 69293.ENSGACP00000024863 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  69293.ENSGACP00000024863
Domain Number 1 Region: 5-342
Classification Level Classification E-value
Superfamily DAK1/DegV-like 8.11e-104
Family DAK1 0.000000436
Further Details:      
 
Domain Number 2 Region: 378-578
Classification Level Classification E-value
Superfamily DhaL-like 1.57e-49
Family DhaL-like 0.0000286
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 69293.ENSGACP00000024863
Sequence length 587
Comment (Gasterosteus aculeatus)
Sequence
MEPKRKLINSVDGCVDEALWGLVRASGGLSLLKGHRVVLRSDLDNLRGRVALLSGGGSGH
EPAHGGYLGAGMLSAAVAGGVFASPPPASILAAILSLHAAGASGVLLIVKNYTGDRLNFG
LAAEQARNRGVAVDVVIVAEDCAFDRPSKAGRRGLCGTIFIHKLAGALAEEGSSLGRIVS
KVTEVLQGVGTLGVSLSPCSVPGSLPSFELPPGVMELGLGIHGEPGIKRSKVASADEVVK
TMIDHMTNPVSHSHLPLKPGPPGDSVVVCVNNLGALSCLEMAVVTRAAVMCLEGRGVVVA
RVMSGSFMTSLEMAGVSLSLMRADQETLRLFDAKTGAPAWPNLSSVCVSGRDYVTDPPAA
SGRPQDDAHSDGPLSPVMRAALERVCSTLLEKRDELNALDRAAGDGDCGDTHAQAARAIQ
EWLQHHAVPGCPGRLLSVLAGLVQDKMGGSSGALYSLFLTAAAGHVTEEQSNAAAWARAM
HAGTQAMRRYGGADPGDRTMLDALCPAVDELMKLTTAPPGGQMSVLRAAVQKAASGAEST
RDLTARAGRASYIAAERVTLPDPGAVAVASVLRAVLESLEGGGGGVM
Download sequence
Identical sequences G3Q4Q9
69293.ENSGACP00000024863 ENSGACP00000024863 ENSGACP00000024863

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]