SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 69293.ENSGACP00000025675 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  69293.ENSGACP00000025675
Domain Number 1 Region: 682-806
Classification Level Classification E-value
Superfamily Regulator of G-protein signaling, RGS 9.03e-38
Family Regulator of G-protein signaling, RGS 0.0000985
Further Details:      
 
Domain Number 2 Region: 992-1091
Classification Level Classification E-value
Superfamily Ubiquitin-like 6.2e-29
Family Ras-binding domain, RBD 0.00092
Further Details:      
 
Domain Number 3 Region: 19-99
Classification Level Classification E-value
Superfamily PDZ domain-like 1.13e-17
Family PDZ domain 0.012
Further Details:      
 
Domain Number 4 Region: 937-1006
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.0000000000305
Family UBX domain 0.063
Further Details:      
 
Domain Number 5 Region: 199-314
Classification Level Classification E-value
Superfamily PH domain-like 0.000000000984
Family Phosphotyrosine-binding domain (PTB) 0.038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 69293.ENSGACP00000025675
Sequence length 1318
Comment (Gasterosteus aculeatus)
Sequence
IQGQPEGARRRLDLNSAAELRGVEVIRGRAGYGFTISGQRPCLLSGIMEGSPADLVGLKQ
GDHIMAIGGSDVSTALHETVVQLIGSCEGPLQLVVQGASRIMANPILNDAKFGTGPKSGV
FQKPAVLRAISHDSSNSSFNSSHSGIAKPRPVSEPDMSQWPQWGGRQTNPFAEQRKKQSS
GDTDPVFTDQANPDWSTLNMTLVVGYLSSTELILNPTESEESCLKAIRERIRLLGTEQST
HTLVMMKVMFDCVRLCDDAGAVLAALPAENLVLGAVCAEDPRFFCLVTTAHVVDGRIPED
GPLRASCHVFFIDPELGNHEDHIGIAGRFGFDCTPDPDALGCLEFPLSPQDVLHFVTVLY
SDMGEAVERLRVKLDAETELQAKEMGDAGKQGSASSNGDSGIGNASPPGERADRDFPSAV
REHPGAHLPSCPWDYPRAEDLPPIKLSKSGQKLHSGNSGGTHSLSESLPGPDSLHKFYGG
PPPRLEFQFKPPPPPLPLNKKANVLGDPLRGSQRWFSKPKWSKALSVDPEPPPSDEWPTS
IGPGTGTGTANPPPPMSNIPSNRYPSAEVMMLPPRQEWTKRFLEQREKQRKDDVAKNVRM
RCGRRGRKGSRFWGMGVTRASKRRASKRMSLARSLDDLESSALSNIYYSRVQLQGCCSQS
SLNSNGSLPGGGSLRGAPEQRVARWAACFERLLQDPVGVRYFSEFLKKEFSEENILFWQA
CEYFSHVPAADKKQLSQRAGEIYNSFLSSKATMPVNIDSQAQLADDVLTSPRPDMFKTQQ
LQIFNLMKFDSYSRFLKSSLYQECMCAEVDGRPLPDPYQIPCSPPSKHSAGSDRSTLSTP
KKKRQEASKQGSGRSLSEESRDLSGDKKRRMFFLWNKSFMEYISKRFVCKYNHWGSNGRR
ESQGSLSSGTSLEMATSCSAGKIESDNRHSAWERSPKHCSVVLPSGSCSSLSLRPGASIR
EVLQDLCRSISINIAAVDLFLVGGEKPLVWDQDCMTLSSRELRVEKRTWFRLDLVPINRS
VGLKAKPTKPVTEVLRPVVAKYGLHLSDLVAKVSGETEPLDLGAPISSLDGLRVVLDRID
SASGKDKSKSSSLKNHPPSKSFSATERQKGGGRGGAQMDEAAIPYARGSLNPDTVLKFFE
LLSRAQSSRANDQRGLLSKEDLVLPDFLRLTPAAACSTPDSLKQGRENGVPPRGSLTAGL
RSESLDSSLGSSANGHSGNRRCLMPPPRHSTFGTHLSPICRPLDTRPILRTVEEDAHGDL
TLVGEGDISSPNSTLLPPSPMPPFDGSLPEANFTPPPPCAPPQDAGGEGKSRSGTSAV
Download sequence
Identical sequences G3Q715
ENSGACP00000025675 69293.ENSGACP00000025675 ENSGACP00000025675

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]