SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 69293.ENSGACP00000026547 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  69293.ENSGACP00000026547
Domain Number 1 Region: 146-455
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 1.48e-98
Family Protein kinases, catalytic subunit 0.00000000005
Further Details:      
 
Domain Number 2 Region: 1-110
Classification Level Classification E-value
Superfamily PH domain-like 8.66e-26
Family Pleckstrin-homology domain (PH domain) 0.00000235
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 69293.ENSGACP00000026547
Sequence length 480
Comment (Gasterosteus aculeatus)
Sequence
MNEVNIVREGWLHKRGEYIKTWRPRYFMLKSNGSFIGYKEKPDLSEQTSPPLNNFSVAEC
QLMKTERPRPNTFVIRCLQWTTVIERTFHVDSNEEREEWMRAIQSVANGLKIREQEEEEP
MDMFGSPNKSSLEEMEVSMSKNRSKVTMSDFEYLKLLGKGTFGKVILVKERSTGVHYAMK
ILRKEVIIAKDEVAHTVTESRVLQNTRHPFLTTLKYAFQTNDRLCFVMEYANGGELFFHL
SRERVFTEDRARFYGAEIVSALEYLHSSDVVYRDLKLENLMLDKDGHIKITDFGLCKEGI
TPDATMKTFCGTPEYLAPEVLEDNDYGRAVDWWGLGVVMYEMMCGRLPFYNQDHERLFEL
ILMEEIRFPRNLSPEAKSLLAGLLKKDPKQRLGGGPYDAKEVMSHKFFIAINWQDVVQRK
LAPLFRPQVTSETDTRYFDDEFTAQTITLTPPDKYNCLDCEDPSQQAHFPQFSYSASIRE
Download sequence
Identical sequences G3Q9I2
ENSGACP00000026547 69293.ENSGACP00000026547 ENSGACP00000026547

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]