SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 6945.ISCW001315-PA from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  6945.ISCW001315-PA
Domain Number 1 Region: 511-783
Classification Level Classification E-value
Superfamily Ankyrin repeat 2.88e-56
Family Ankyrin repeat 0.00045
Further Details:      
 
Domain Number 2 Region: 150-229
Classification Level Classification E-value
Superfamily RING/U-box 2.08e-24
Family ZZ domain 0.0081
Further Details:      
 
Domain Number 3 Region: 88-163
Classification Level Classification E-value
Superfamily Mib/herc2 domain-like 4.84e-23
Family Mib/herc2 domain 0.001
Further Details:      
 
Domain Number 4 Region: 3-73
Classification Level Classification E-value
Superfamily Mib/herc2 domain-like 5.89e-22
Family Mib/herc2 domain 0.001
Further Details:      
 
Domain Number 5 Region: 236-293
Classification Level Classification E-value
Superfamily Mib/herc2 domain-like 0.00000000000000118
Family Mib/herc2 domain 0.0011
Further Details:      
 
Weak hits

Sequence:  6945.ISCW001315-PA
Domain Number - Region: 944-989
Classification Level Classification E-value
Superfamily RING/U-box 0.000265
Family RING finger domain, C3HC4 0.023
Further Details:      
 
Domain Number - Region: 873-915
Classification Level Classification E-value
Superfamily RING/U-box 0.000471
Family RING finger domain, C3HC4 0.023
Further Details:      
 
Domain Number - Region: 817-855
Classification Level Classification E-value
Superfamily Ankyrin repeat 0.0497
Family Ankyrin repeat 0.0081
Further Details:      
 
Domain Number - Region: 432-460
Classification Level Classification E-value
Superfamily NfeD domain-like 0.0785
Family NfeD domain-like 0.0063
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 6945.ISCW001315-PA
Sequence length 996
Comment (Ixodes scapularis)
Sequence
MSVELGLRVVRGPDWKWGNQDSGEGHVGTLVEVGKAGSSSSPDRTVVVQWDSGSRTNYRV
GYQGSYDLRVFDNAPDGGPGAEVAAEPAAAMSVELGLRVVRGPDWKWGNQDSGEGHVGTL
VEVGKAGSSSSPDRTVVVQWDSGSRTNYRVGYQGSYDLRVFDNAPVGVKHPNIICDACRK
QGISGTRWKCARCYDFDLCTQCYMADKHDLTHPFVRFDTTASTGVEMPKRQGAVKIAARG
IFVGAKVVRGPDWDWGAQDESGRSVASVTWSSGSTNVYRLGHKGKVDLKYIQDAPGASST
GTTLPILGVGSAVDPQAPRAGAQAPLHSQFSVGDRVEVLLDIESLKIMQDGHGGWNPRMS
EVIGKIGTVHRVTDRGDIRVQYEGSNNRWTFHPDALTKVVMFSVGDMVKICDDLQRLKEW
QVGHGEYIDAMKGCLGKLGKVTKVYTDGDLRVNVDGQTWTFNPLCVVPVPGSATEISNTM
TANTREEHASHHLLSEGGQPVAGDTGALDRLVREAAQGHTDFVREHLAKHPDRVNQKSSG
KTALQVASHQGHQEIVELLLQCAASVEAQDDDGDTALHYAAFGNQPVIMEQLLKAGAHVN
AVNKAKCTALHVAVNKQHANCVRVLLKFRSILNDSYGDTALHDAIGKDNLEIIDLLINVP
EVDFSLKNKRGFNVLHHAALKGNNFATERLLSRTRQIVDIKKDDGFAALHLAALNGHFLV
VETLLIQGQCEADVRNNRKQTPLLLAVSQGHCAIAELLLGAGGAQVNAEDEDADTALHLA
LIKRSAIRPQDLDPAEAPVIAGIASQLGSSPLPEVDGTLALACFLAKEGADLNKSNLVGR
TPLDLAGSPIVADLLQHWKAHKEWAAPVEVVPGSECQICLEALATVVFEPCGHRVACEEC
CSRMKKCLSCQQIIVKKTDPAGKPLMSRARQASLERLRYLESKVQEMEESQGCSICMERR
RNVAFLCGHGACALCAQTLRTCHMCRKAIAKKIYLY
Download sequence
Identical sequences B7P3H6
XP_002404176.2.51680 6945.ISCW001315-PA ISCW001315-PA

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]