SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 70601.PH0287 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  70601.PH0287
Domain Number 1 Region: 184-401
Classification Level Classification E-value
Superfamily Multidrug efflux transporter AcrB transmembrane domain 2.49e-42
Family Multidrug efflux transporter AcrB transmembrane domain 0.0014
Further Details:      
 
Domain Number 2 Region: 588-782
Classification Level Classification E-value
Superfamily Multidrug efflux transporter AcrB transmembrane domain 8.76e-36
Family Multidrug efflux transporter AcrB transmembrane domain 0.013
Further Details:      
 
Domain Number 3 Region: 508-611
Classification Level Classification E-value
Superfamily Globin-like 0.0000245
Family Truncated hemoglobin 0.052
Further Details:      
 
Weak hits

Sequence:  70601.PH0287
Domain Number - Region: 109-156
Classification Level Classification E-value
Superfamily GST C-terminal domain-like 0.00786
Family Glutathione S-transferase (GST), C-terminal domain 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 70601.PH0287
Sequence length 787
Comment (Pyrococcus horikoshii)
Sequence
MFAKVSMIIFLASLIPIFVHHNVFKFQNYKTFGNFRKLGEIMLRKIARIIVVYRHSLAVI
TIFLLILSGYGITKLKFESDLSKQLPEDLEAVKNYFTLQNEFGGSGSALIYVKIKSPDKV
ADIRDPTVIKAMYSLEQRLKDKEYVTDTFSIADLAVQILGRLPNNIEEVKFVLNMLPEDA
RNGLVSRDYSSTIIIVSLNREKNQRALVRVYNEIKNEIEKSNFPEGVEVVLTGDLGITYK
ILEMLQNDMNRTMAVAGIIVIILLLYFYKSPIRMLVPLIPLIFGVTMTLGFMGLLGIPLD
IATSTVGAMIIGMGIDYGVHVTNRYYEERNKGRSPEEAAEEAISETGKALLGAALTTIAG
FLALSLSILPSLKRLSISLVMGLGLAAVNAVIVTPALAILEEEFRTKILGKKGEIISIGG
EEGKLGFIFSRLGLFIKRSPWLALLIAVMISGVSLYGATKITTEVRLEKMIPMDMPEIQA
LTDIRSEFGGQDEITILIKADDVRDPEIVRSILRFEREVKADSYINNVFESESIADVVIE
KYGYIPEDKEKIAKALEGSSLVSSDYSLTIVKLKGNFMGVTQEDFNKIMEYFEEELKRAN
FPPGVKAELAGESYLNYVLDNLVNEELGKISTIGTIIVVLIVFAIFRRPTVAVAMIMPMF
LGALWTIGYMGLAGIPFSQTLAGVVSMIVGLGVDYGMHITHRFLEELKEGNKTPIITAME
SVGPGILIGALTTAGGFLALLTGRLTAIHDFGKVLAVGIFSSMLAAYLVTPAILQLEFGR
KIKEVKE
Download sequence
Identical sequences O58025
gi|14590211|ref|NP_142276.1| 70601.PH0287

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]