SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 7070.XP_974158 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  7070.XP_974158
Domain Number 1 Region: 926-1051
Classification Level Classification E-value
Superfamily cAMP-binding domain-like 5.37e-18
Family cAMP-binding domain 0.0054
Further Details:      
 
Domain Number 2 Region: 643-777
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 0.000000118
Family Voltage-gated potassium channels 0.022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 7070.XP_974158
Sequence length 1271
Comment (Tribolium castaneum)
Sequence
MPKINLLLILALCESCNAFLNRTVGSDNPRAIYPSIPAEHNVFYFFVIVMLATIIRIVLI
RYDIPTPYGAFMIMVGVIWGIICNHNLFVLLASDAMNTNPVDLVCVYLPALVFSTSFSLD
VPIFLKTIPQLLVIGIFVTFLTGTLFGVLMRLVIEPSWSIKVGLTFGIFIVPINPASIVY
LLKQQTTATRHISALLEGEAIFNMLLAEMTHDLIINFAKGFVVHWYQFVMVLIRFILFGI
AFGYFVGLLGRYMMRTLYRYPLTIFMISFGFPFFTFFLSDIYISGCGSISVMILGTMMAM
ERSVLAKETNQFLTDMWETIGYSLDAVMCVTITLLATVEVATIVTTSAYIRIIVTYLTYY
SIRFICFLLFAPIISRLGYGMDLKCMIVCVWSGLKSPFSLALSLIFVEDAISAEKMKRIF
FQCVGIYFLSVLINGTFTRKILEFLGLREISMARKINMTNCMKHIFTKRNKTVAILKMDR
FLADVNWPVVLEATDMKHPYRMGMEDTEEDNFFLLGYRFTVCPDCKSEIPKEPTTRELKD
MAKEAKMRVLKSKKMCYARQYENGMMTKEGIKILSQAVELAMDTEAAVIQLEGLEKRFKE
ENCIYRCIRKKVKHLNRSQADSIRPPRKYFRRLCYRICINNTFEHFMLVIITIHCVFITV
STIYHPPIDHLDTIDKKLDVAISVLDLIFSIIYIVEVILKIMAFSWIHFWEHGVKTYFKS
VWRNIDFLVVVTCILQGYYDLKCFYAQIPESKYGVFYRVLTCLRLLRVVRLFTVLKIFYP
KFVTYLDRSVDSQLAFTYELGKSYAIGETEILDMLPYMIDNTAIREEIKQKIERDKVIIT
KLLGMVQKEKPWIAITVKTKQAIRTILNSMKEAANQLRTAGWVDDYEQEKLFQVMGELWS
KVNSIKSVQPSAPKVIFKEVAWMAGDQAVIDFLFENVTVKKFEPGDVVFEEGTVADGIYI
VVTGLFMIIYKPESNVLTSLHEYGQLPIADYLSATQYEERVVDYIVSGNCIGELSTLTGR
AYNCTVSADAHCQVYVLSKGVIKRAMELNPDPVIGLECRLWKEVSIRMAVPLLMSVPAYQ
GFSQDQIKYALERAFVPNLSNYKIFAVTDMIEDIILIEGCAADFNTRESFVAPCCIPRTV
QKLILPKSSLINIPVLLETKLLIIPEKDVDEYDVMILAEDMCELVDTGASMKCLQHATQE
KTRKKKVKMMAARKKGTAVSKTLSKLQPDSNDSVGMLFFKRTDSETNSINMEEEEENKRN
AEQTKQSKTNP
Download sequence
Identical sequences 7070.XP_974158

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]