SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 7176.CPIJ019876-PA from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  7176.CPIJ019876-PA
Domain Number 1 Region: 262-454
Classification Level Classification E-value
Superfamily cAMP-binding domain-like 3.14e-45
Family cAMP-binding domain 0.0002
Further Details:      
 
Domain Number 2 Region: 112-257
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 0.000000149
Family Voltage-gated potassium channels 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 7176.CPIJ019876-PA
Sequence length 609
Comment (Culex quinquefasciatus)
Sequence
MCIVPKGCKYFFYILSPQPNANDFVTGRLRHLANRFSERTKRMRNKLEIPPTPSSSASAP
STAPSTQKHNVELRAIQNSALTLQSATGTNTCTHHYFCPIFCAGTKTNTVLDPQGKFYIS
WLFIVSLSFLYNAWVIPLRSSFPYQTPENTKYWIAVDICADVIYLIDILFVKHRVMYLFE
GFWFEVFIVLMSRLQPVGLQQQGPRVRAVLCIRNQTATSIGKNPKPEKEGELLFMTAAWL
MGVFVFALLIGQIRDIIATATRSKSEYKQLVDETLEYMRQLNLPTDLQRRVKMWFTFTWE
QQRSLDETHIMDALPANLKTDIAISVHIQTLSKVQLFADCEEALLRELVLKLRSVTFLPG
DYVCRKGEVGKEMYIVKTGQVQVMGGPRSDVVLATLYEGSVFGEISLLAINGAEGNRRTA
DVRSKGFSNLFVLSKSDLNEAIVYYPNAQAILKKRAKSLMRKNAAREKAESQQSINTNDA
DTDVVISNPDHSTSPKLLKTVIQALPRESAAVQLLTQGFKGELGVKANGVEPPKADDAIS
THSLEVHTTQVQIENEKNVDLPCDLMYSIKKELMDNNSYINLTDAEKYELLNELSKESKE
DYGQQKSPV
Download sequence
Identical sequences B0XKD4
7176.CPIJ019876-PA CPIJ019876|cyclic XP_001870106.1.94360

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]