SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 7227.FBpp0070575 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  7227.FBpp0070575
Domain Number 1 Region: 117-226
Classification Level Classification E-value
Superfamily TPR-like 3.8e-25
Family Tetratricopeptide repeat (TPR) 0.0024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 7227.FBpp0070575
Sequence length 377
Comment (Drosophila melanogaster)
Sequence
MAFTMQTGDLKKLKYFIDFALENPTFLNMPQLQFVKDFVEKFGGTVPPGQFNGGSAGGKC
PFGGVAGAKANEPANAPEDSEDEKSLSDPESDVELDMEGVIEADSDPAQPMGNYSKKATE
EEVEQASELRAQAASAYGQQKFDEAIALYTKAIELSPGNALFHAKRGQAFLKLKKPNACI
RDCDVALELNSDLAAGYKFRGRARRLLGDFELAAHDLRQACKLDFDEETDEWLKEVTPNA
KKIEQHRLKQERRQAERKIKERQRDQRRARKEQEKHNASSGGSSGEFSGGNPGNGNMSDI
LGAMSDPEVSAAIQDILSNPGNITKYASNPKIYNLIKKIVPGGDVGAAFGQAGEKAGKPS
EPKPKKDSADFVDDGLD
Download sequence
Identical sequences C4NYP8 E2QD63 Q86DS1
FBpp0070572 FBpp0070575 FBpp0070572 FBpp0070573 FBpp0070575 NP_001014719.2.81976 NP_570074.3.81976 NP_726885.1.81976 NP_726886.1.81976 7227.FBpp0070573 7227.FBpp0070575 FBpp0070572 FBpp0070573 FBpp0070575 FBpp0305905

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]