SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 7227.FBpp0072096 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  7227.FBpp0072096
Domain Number 1 Region: 10-250
Classification Level Classification E-value
Superfamily TPR-like 6.07e-43
Family Tetratricopeptide repeat (TPR) 0.0047
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 7227.FBpp0072096
Sequence length 302
Comment (Drosophila melanogaster)
Sequence
MSGIAAKKIAEAEDLVKQAEKSLKLSMLKWVPDYDSAADEYSKAATAYRIAKSYDKSKEC
FLKAIDAYKNNKSWFHAAKAYEQIILLSKDADKLHEVEEYANKSASLYQQHGSPEAAASA
LDKAAKLTESKHPDMALRFYQHALEVIMIEDSVRQAAEYASKVSRILVKLRRYDEATNAL
KKEISLNQQTESYGQIGRLVVALVMVQLARGDSVEAEKTFREWGNCCEPEEVSTLQTLLQ
AFDDEDPELAARMLASPFIRHMDVEYAILSKNIPLPQGIQMEKKAGDTAAETNDAEDEGG
LC
Download sequence
Identical sequences Q9U6R9
NP_477469.1.81976 7227.FBpp0072096 FBpp0072096 FBpp0072096 FBpp0072096

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]