SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 7227.FBpp0077718 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  7227.FBpp0077718
Domain Number 1 Region: 256-540
Classification Level Classification E-value
Superfamily TPR-like 7.97e-22
Family Tetratricopeptide repeat (TPR) 0.011
Further Details:      
 
Weak hits

Sequence:  7227.FBpp0077718
Domain Number - Region: 9-39
Classification Level Classification E-value
Superfamily TPR-like 0.0759
Family Tetratricopeptide repeat (TPR) 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 7227.FBpp0077718
Sequence length 549
Comment (Drosophila melanogaster)
Sequence
MASAMLATLELDYFRAVSLYRRRSYERCAELCNALLQAGHDGHVQLFTTKEEEEEEQHQQ
QQAEHSRFGSNLQRIGPRPRGAAGGGAGAVDSGPSIMMPTWLMEGVWQLKMRALTQRVYV
DDLDEDDGGNEATEEVEFERIATAARPGSSIKTAFQPRPLTSQRAQQARSRGAGVAHSSD
GRLNSSRPGSAAVARPGTSLSRPGSSLGSRCGTASRIRATSAAAFNVGDATSKLYQASRL
NPTIYAERETLVKALFQFLYYHEADVQKAHSLCQAVLEVERQKPSGSTGCTLSWWWQQQM
GRCLLALHYPRRAEPFLQQSLTSFPHPDTYLLLSRVYQRIKQPERALLVIGEVVDSRPFD
VTYRLEQARIHQAMEQQEDALQLYRLAAKLHPINVESLASIAVGYFYDNNPEMALMYYRR
ILSLGAQSPELYCNIALCCLYGGQIDLVLPCFQRALATATQPGQKSDIWYNLSFVAVTSG
DFNLAKRCLQLCLTSDAQNGAALNNLAVLAAQSGDILGAKSYLNAAKDVMPDAAEVTTNL
QFMDVHYKL
Download sequence
Identical sequences Q9VPP9
NP_608524.1.81976 FBpp0077718 FBpp0077718 FBpp0077718 7227.FBpp0077718 FR710

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]