SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 7227.FBpp0080138 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  7227.FBpp0080138
Domain Number 1 Region: 45-429,710-862
Classification Level Classification E-value
Superfamily TPR-like 2.24e-75
Family Tetratricopeptide repeat (TPR) 0.0015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 7227.FBpp0080138
Sequence length 1177
Comment (Drosophila melanogaster)
Sequence
MEVTFSSGGSSNASSECAIDGGTNRCRGLEPNNGTCILSQEVKDLYRSLYTASKQLDDAK
RNVQSVGQLFQHEIEEKRSLLVQLCKQIIFKDYQSVGKKVREVMWRRGYYEFIAFVKKNW
HKQCQDAATAQENMQKLERFLCAGIFNYKRLSARMEEIYDLDLKYLIDFSIISDGYISDM
IGDTMESSHSGTHAVDKSLEAVSFALDTIHSSLLSLGDLHRYFLDFRIDSKLSISKEQVA
KYYLEAFKLNPAIGMAQNQLGTLHYGQNHDLDSTYHYLYSLVCIIPFELSENNLNKLFAK
HTEYLERMDPEKLDFNIEDFFARFYLIVDIFFFDKEVPDFNALCHCVLIDLRKILCSQQL
RVPEPSIFKIVSILFFCLSKLKMINSPKVYSLHAFLVAACSDLMDACIVSIEQTILARAQ
DNERFQAEYEERFQEFDTVVRKSRNEYKNWLAAVGECERKDKKLMPRPHSLKDCSSDSRD
SQHSGEEAKTQEAADGDKIGEAVSTRSSDEAKESDLKTPLSCKSKRRGMRLRRRRRKIAQ
SDDSSCYDSESELDTDFYSDEEDYTDLSSNFDTDFSDIDAADPGEPCGEERYAAANYSKK
ERKAGGGGGGGVGGVVYSDNEDVVIEEEKIVYPNEVERRSNSQEADSEELLRSFEVLQLN
FKSAEDAQSKPVAPPPVSFSEPPKKLVYRNKYTKINPNIVIDCLHNEPTIRALKMLFDWL
RINPEILIGCYHSNPEFVHKIMKLLNYCNIDIFTRKVYFERDLLTTANVRDSLVELFDVR
ANVPLTEDFAFKNFDIFQSTQITLDWETIIRERVTPQEESILRIFKMVDFGFFICKQKKF
NYRFCVKTRRFTETQKKKQREEKKGGGSRRRERRTAPKTNRTKRNEGRTRRYSDRKNGIV
RKSYTSNEEKDTVEECRKMPRKGYLRNRNAEKAAAVITSATGTSVAGGTSASTTTNSVIE
KLNLQSSSGADEERSEAKSKKCELMGKLWLQNEVETLEEELRDSPAHVVMSPFVVVDSKA
LTEYNGIVKSLVRTKKCIVLIPNAVLNELDDLKKRSENVRHVIRWLEQEFKQGNRHLRAQ
RDNESQPLSLLKISRKMDRDASVFLQIAQFCNHLVANHADPHVSELQKSVVTYLSGDNLH
EKNRQQQNFSYTGILDSIPVRYAQIQSFYAKFKANKK
Download sequence
Identical sequences Q9V414
FBpp0080138 FBpp0080139 7227.FBpp0080138 FBpp0080138 NP_001285914.1.81976 NP_609685.1.81976 NP_723851.1.81976 FBpp0080138 FBpp0080139

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]