SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 7227.FBpp0081673 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  7227.FBpp0081673
Domain Number 1 Region: 10-244
Classification Level Classification E-value
Superfamily TPR-like 3.04e-36
Family Tetratricopeptide repeat (TPR) 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 7227.FBpp0081673
Sequence length 283
Comment (Drosophila melanogaster)
Sequence
MSTLDAKKIEEAEALIGQTDSAANEYAKAGMYFKAATAYRIAKSFDKRKDCLLKAIDCYE
NNKSWFHAAKSYEQIILLAKETDKLSEVEDYANRACCLYQQHGSPEAAAAALDKAAKMTE
SKHPDLALGFYKRALAVVLIGDSTHQASEFASKVSRILVRLKKYEEATKALKKEISLNLQ
TKSYGQVGRLVVALILVQLTLEDYVDAKKTFKKWGNRCDPQEVNTLQNLLKAFDDEDPEL
ATKMLASPFIRHMDVEYALLSKDVPLPKGNRQMTKNAVDNAAN
Download sequence
Identical sequences Q9VH25
FBpp0081673 FBpp0081673 7227.FBpp0081673 NP_649980.1.81976 FBpp0081673

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]