SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 7227.FBpp0082652 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  7227.FBpp0082652
Domain Number 1 Region: 106-206
Classification Level Classification E-value
Superfamily TPR-like 0.00000000000000826
Family Tetratricopeptide repeat (TPR) 0.0031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 7227.FBpp0082652
Sequence length 225
Comment (Drosophila melanogaster)
Sequence
MDADESFLNQRSLLMDVMKQLEDLQNANKMDTGTKGKEEKKPEVDPSEGVTITNFMVFAR
DVRKKSSRYLKRVQKMSNINQISFMRQIDVSPKDRAEARRDREIVADSFRRLGNEEYRRT
NYEKAVYFYSKAIQYVADSPVLYCNRALAKIKKRDFKLALFDLDYVIFNLDPIHLRAWLY
RAGALARLNNESEFEIAIANARLLNRSQKDKKYIEYFLEKFKTEF
Download sequence
Identical sequences Q8IND4
FBpp0082652 NP_732055.1.81976 FBpp0082652 FBpp0082652 7227.FBpp0082652

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]