SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 7227.FBpp0083435 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  7227.FBpp0083435
Domain Number 1 Region: 179-250
Classification Level Classification E-value
Superfamily TPR-like 0.00000000778
Family Tetratricopeptide repeat (TPR) 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 7227.FBpp0083435
Sequence length 286
Comment (Drosophila melanogaster)
Sequence
MDWYVGTEWEDKNRGLAKKVIGLQFTEMDKPTIISTVEFSVNKKATNLGGRPSKYLVSDE
SATYPQKHSLEMGTSLTAVDCYLELLLQQFVPGETAACSITTKTGERIEFELKLEKIVKN
TQVEKLSAAEIYEVALRLKESGVATFKTFPKFAFDYFVRAAKLLITYKPFDKLTKKTNGI
NGQAVEELFIQIQTNLAACLLQEKRYEHVIYHTQFVETEESPSEKSIYRRALAYYHLKEF
AKAQATIERMPNYEEKREFSKLRDNIAVSWKDSKAHYKEVVQRMFS
Download sequence
Identical sequences Q9VDE4
FR683 FBpp0083435 FBpp0083435 7227.FBpp0083435 FBpp0083435 NP_650943.1.81976

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]