SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 7227.FBpp0084559 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  7227.FBpp0084559
Domain Number 1 Region: 196-381
Classification Level Classification E-value
Superfamily TPR-like 1.55e-29
Family Tetratricopeptide repeat (TPR) 0.013
Further Details:      
 
Domain Number 2 Region: 73-176
Classification Level Classification E-value
Superfamily TPR-like 1.63e-17
Family Tetratricopeptide repeat (TPR) 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 7227.FBpp0084559
Sequence length 658
Comment (Drosophila melanogaster)
Sequence
MSSLSASAENVSSLGLGSGGGGTTSHDGNSQQGSGSDGGSSMCLELALEGERLCKAGDCR
AGVAFFQAAIQAGTEDLRTLSAIYSQLGNAYFYLGDYNKAMQYHKHDLTLAKSMNDRLGE
AKSSGNLGNTLKVMGRFDEAAICCERHLTLARQLGDRLSEGRALYNLGNVYHAKGKHLGQ
RNPGKFGDDVKEALTRAVEFYQENLKLMRDLGDRGAQGRACGNLGNTYYLLGDFQAAIEH
HQERLRIAREFGDRAAERRANSNLGNSHIFLGQFEDAAEHYKRTLALAVELGEREVEAQS
CYSLGNTYTLLHEFNTAIEYHNRHLAIAQELGDRIGEARACWSLGNAHSAIGGHERALKY
AEQHLQLAKELHDPVGESTARVNISDLRKLLGMPDSEPSPTEEEARSTASDHSASGNQSD
GSENSQGRMVRVRRQSMEQLDLIKITPDGKRMQEEKLRAQATRKAKDDDFFEMLSRSQSK
RMDDQRCSIKVNPAGAPAVATGATRKPLVQQNSLFVDPTNLPGLKSPSSANPSAIGHGPL
ARSATTTQQPDDDFLDMLMRCQGSRLEEQRSELPRPNVTMDAEAEAPPRSVPEAAVPGAP
RGQTGRGATVPDEDFFSLIMKVQSGRMEDQRASIPFRNANNNNNSRSNNNGSAGGAGK
Download sequence
Identical sequences Q9VB22
FBpp0084559 FBpp0084559 FBpp0084559 7227.FBpp0084559 NP_524999.2.81976

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]