SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 7227.FBpp0084691 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  7227.FBpp0084691
Domain Number 1 Region: 680-965
Classification Level Classification E-value
Superfamily TPR-like 1.94e-43
Family HAT/Suf repeat 0.0077
Further Details:      
 
Domain Number 2 Region: 370-557
Classification Level Classification E-value
Superfamily TPR-like 9.1e-34
Family HAT/Suf repeat 0.0017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 7227.FBpp0084691
Sequence length 1066
Comment (Drosophila melanogaster)
Sequence
MASEGENVVMESPGRRTRSGRKAASPAASLPTRSTRRTSKRNVQLSDHEEEAEEQVVMVQ
EEEEPFRGTNTAEAPALEPQFEETQHQIEDDVEMLPAEAAGVDEKSSSFPFGTVAELHSE
TSDDIKETRGQAGVDTLLASLAGDNANSLPSVGGNDESDNVKKADFEYNVDSLQPQMEKM
NSSEDSSSQHAIAEDLADADTSNATIVNTEIVSEDELPLPSKPEINDAEEVSDEELPAPQ
RAELPEDAEVISEDELPASNNNNTATEPKAPLKRKAENESVKSTEDKDASSHESSTKDKS
SEQYNPGSPTSESNDAQPSEKKLKVEESEPKEKKKEKERDKDKEKDKDKDNNKDKEKERK
KLPDLDKYWRAVKEDSTDFTGWTYLLQYVDNESDAEAAREAYDTFLSHYPYCYGYWRKYA
DYEKRKGIKANCYKVFERGLEAIPLSVDLWIHYLMHVKSNHGDDETFVRSQYERAVKACG
LEFRSDKLWDAYIRWENESKRYHRVVQIYDRLLAIPTQGYNGHFDNFQDLINQHDVTITL
ANEEVIRLRKDFHERQQSKSSKSSSKHRRDSSSSSKDKDSKEREREKDKDKDKDKDKEKR
ETVGGGVGKSPKDTSETQVDESDSTTDLTTESESSHAASKPAMQIDFSDLSTLNDEEVVS
IRDRAISARRKVHKLTVSAVTARWSFEEGIKRPYFHVKPLERAQLKNWKDYLDFEIEKGD
RERVLVLFERCLIACALYDEFWLKMLRYLESLEDQSGVVDLVRDVYRRACRIHHPDKPSL
HLMWAAFEECQMNFDDAAEILQRIDQRCPNLLQLSYRRINVERRRGALDKCRELYKHYIE
STKNKGIAGSLAIKYARFLNKICHDLDAGLAALQQALERDPANTRVALQMIDLCLQRPKV
DEQEVVEIMDKFMARADIEPDQKVLFAQRKVEFLEDFGSTARGLQDAQRALQQALTKAKE
AQKKSDGSPSRKNSSSSKEGPVPTGSAAAAYNNGGSAAAVAGYNYGAANPYYGQQNTAAA
YPSQTPQQASYDSYYNQWGYGSGGASANSGGSGYNYGQWSGYGNYY
Download sequence
Identical sequences Q7KRW8
NP_733256.2.81976 FBpp0084691 FBpp0084691 7227.FBpp0084691 FBpp0084691

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]