SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 7227.FBpp0088149 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  7227.FBpp0088149
Domain Number 1 Region: 112-284
Classification Level Classification E-value
Superfamily TPR-like 0.0000000000000417
Family Tetratricopeptide repeat (TPR) 0.034
Further Details:      
 
Domain Number 2 Region: 454-508
Classification Level Classification E-value
Superfamily RING/U-box 0.0000000302
Family RING finger domain, C3HC4 0.028
Further Details:      
 
Domain Number 3 Region: 292-436
Classification Level Classification E-value
Superfamily TPR-like 0.0000000334
Family Tetratricopeptide repeat (TPR) 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 7227.FBpp0088149
Sequence length 606
Comment (Drosophila melanogaster)
Sequence
MSWESINSKDLLSIPPSQNLSATRLLTSPDGSRYLLENSSDLCHLDESFSRLAGYGSSPD
VGSRSVWASQALLRSGSVISCFLSCQQSLRQYIAKRKIERGRRLYEQNNQTEAVRTWRSA
LKGTCQREDCFQLLGYLYQAHMDWGKFREAIEFSHQQLGISEELDSPNMRAETYLNLSRA
HASLGGLERSLSYARHSLYNECGTKCRSGLVHLTVARVYLEMGGFSRALEGLQGAYKIAT
AIGDPSLELQVYVALSELFGRLQDNDKSATYASKAYDLSRSLQLGDLNSCHHRAALLRMA
VSLRKQGELGDAQDYCKEATKLSLISGDQATYTRSIRVMGDIYRNKMDMDRAFRQYEQAM
GTSASLGDRMAQMEAMDGAARCLETLRLQNKICNCRPLEFNTRLLEVASSIGAKFLVRKI
RCRLALIYRALGDEDQYNTHFRLANQTDAALGLNCGACGELLGLRPENLEALPCAHILHA
RCAYEILRRREKNAPRSCPACNKLISSRTHFCGSVPVESESTDRCVTAASTFNTNSLSVD
GLLGINSDILLPSAAFCYVKNPALDTENSALLSPKVIYHSNLSLASLSMRASSLTIDSGQ
NVTSSV
Download sequence
Identical sequences Q7K4Y8
FBpp0088148 FBpp0088149 7227.FBpp0088149 FBpp0088148 FBpp0088149 FR705 FBpp0088148 NP_651928.1.81976 NP_726586.1.81976

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]