SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 7227.FBpp0111406 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  7227.FBpp0111406
Domain Number 1 Region: 117-221
Classification Level Classification E-value
Superfamily TPR-like 2.61e-19
Family Tetratricopeptide repeat (TPR) 0.0052
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 7227.FBpp0111406
Sequence length 233
Comment (Drosophila melanogaster)
Sequence
MYSLQHPQIDECFLDSESTVEEVVRLLENLQVPNEEEAEGQEKPKRSLKSSTITEESFII
TERKTPIPVISAPTSSKEKSKPRTFNRIDRSKDRFPFMRQVEMDLDQRSKARLERERVAQ
NFRKLGNAEYRKGNYEAAMKVYTEAIENIRDSHILYINRALCFIKSGKFKRGIVDCDFVL
NKLDEKNLRAWMYRAMAYKGLNDESNFENCVKYARKFNSKQMDFIDDFLEKLK
Download sequence
Identical sequences A8JQU5
7227.FBpp0111406 FBpp0111406 FBpp0111406 NP_001097696.1.81976 FBpp0111406

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]