SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 7460.XP_397307 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  7460.XP_397307
Domain Number 1 Region: 3-217
Classification Level Classification E-value
Superfamily Ribosomal protein L1 8.11e-71
Family Ribosomal protein L1 0.00014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 7460.XP_397307
Sequence length 217
Comment (Apis mellifera)
Sequence
MTSKVSRDTLYECVNAVLQHSQDKKRKFLETVELQIGLKNYDPQKDKRFSGTVKLKNIPR
PKMQVCVLGDQQHCDEAKANNIPYMDAEALKKLNKNKKLVKKLAKKYDAFLASESLIKQI
PRILGPGLNKAGKFPGLLSHQESMVGKIDEVKATIKFQMKKVLCLSVAVGHVEMTPDELV
QNVHLSINFLVSLLKKHWQNVRSLHIKSSMGPPQRLY
Download sequence
Identical sequences A0A2A3EL38
ENSAPMP00000004552 7460.XP_397307 XP_006563278.1.77095 XP_006610626.1.66377 XP_016907667.1.2121

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]