SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 7668.XP_789946 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  7668.XP_789946
Domain Number 1 Region: 266-448
Classification Level Classification E-value
Superfamily cAMP-binding domain-like 2.88e-40
Family cAMP-binding domain 0.0008
Further Details:      
 
Domain Number 2 Region: 39-259
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 1.23e-28
Family Voltage-gated potassium channels 0.005
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 7668.XP_789946
Sequence length 889
Comment (Strongylocentrotus purpuratus)
Sequence
MRRKRNASTDKSEVLRLTSDEINHKKLRVRQLHKFTILHYSPFKAVWDWFILLLVVYTAI
FTPYSAAFLLKNDENKVNGDSLSQSYTQPLVFIDMVVDVMFIVDIFINFRTTFLDDSLGE
VISNPSKIAKHYLKGWFVIDVMAAIPFDLLLFSVAADEVKTTVGLLSTITMFTQIKQRKE
IQRYNDCNVSIIYLRRREIMCTYVLINHWLACKCTFTTVGFGNIAPLTDAEKLFXICMML
IGSLMFACIFGNMTAIIERLYAGISRYQQQLNLVKEFVKFHNVPNPLQSRLKEYFKHAWV
YMNGNDFHEVMADFPDFLQADISLHLNRNLLKESNAFRGVNHGCLRALSMKFKTTHTAPG
DILIHKGDSLNIMYFISRGSLEILQGNLVLAILGKNDVVGENFCTCEDVGRSKGTVRALT
YCDLVTLARDDLMDVIRSYPDFKEHFAEKVEITMDMRDYDPSERRPSAVPEKDIEADKTT
TPPKKTSSTRNNLSVSNTRLTITPMQSSENLQTIYRATSPSTRRRFRKRSEKSRSQSQES
SKRTTVDIEMNRLNADDDEEEDEGEDAPMIPKHTSSPRAPQKRESIPHSPLKETQYMAAS
EPQLAETKQRGRVSGGLGIRGTPEGAPTSSSTGQIAPSAVHIVDANKLVCDRAVHNKIDE
LYLQLDNIERSFDEKRNEIIDVLLKEQKQKEMAVIAQTMQQDAQTLLHNIMPSTNTNQQI
PSVSNRVPATLASVITGNNGTSNDLHDVDRLLSQPFPGDQPVDVPVLLPESNSHSMPRQQ
SMYSSNTMPRVKKCEQPSESYTETQTLHRQSRSPRSDKRSSSTRSQRPSSASGRVSTAHR
SVSGHNLQAASSTPSVSGRLSTDTPEDIWLERTDNRKKKDDSIISSTYC
Download sequence
Identical sequences 7668.XP_789946

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]