SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 76869.PputGB1_1542 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  76869.PputGB1_1542
Domain Number 1 Region: 7-179
Classification Level Classification E-value
Superfamily Transmembrane di-heme cytochromes 4.39e-29
Family Formate dehydrogenase N, cytochrome (gamma) subunit 0.062
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 76869.PputGB1_1542
Sequence length 181
Comment (Pseudomonas putida GB 1)
Sequence
MVSSTPATHYARLSIALHWLMLVLLAAVYALIELRGLFPKDSAERNLMKDLHFMLGLSVF
VLVWLRLAMRLSRPTPPIVPKPPAWQTGLAHLMHLALYLLMIGLPLAGWLILSAADKPVP
FFGLELPHLIGPNPDQAKFIKGWHERIGSWGYWLIGLHALAGLYHHYVQRDNTLLRMLPY
K
Download sequence
Identical sequences B0KFA7
76869.PputGB1_1542 WP_012271214.1.13892 WP_012271214.1.54657 WP_012271214.1.65540 WP_012271214.1.66485 WP_012271214.1.81634 gi|167032552|ref|YP_001667783.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]