SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 76869.PputGB1_2188 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  76869.PputGB1_2188
Domain Number 1 Region: 29-366
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like II 2.45e-90
Family Phosphate binding protein-like 0.0000000343
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 76869.PputGB1_2188
Sequence length 367
Comment (Pseudomonas putida GB 1)
Sequence
MRKVLKMIGGLLLASGASLAQAAEVDSANTLRLYNWTDYIGETTLADFEKATGIKVIYDT
FDGYETVQTKLLTGRSGYDLVMLNASLVPPLISAGVFQALDKQQLPSWHNLDQQVVDNLQ
GYDPGLKYSAPYTWGSSGVTYNVDKIKARMPDAPIGSLAMLFDPKIVSRFADCGVTLMDA
PTEVIPLALQYLGKDPRSASPADLKAAEQLLLGIRPYIRKFDSVNYLTSLPNGDVCLALT
WSGDYATAQARAVEAKKDIKLSFFIPQEGSLIWFDNLYIPKDAPHAANAHRFIEFLLQPQ
TMAKVTDYIHYANSNAAATALVRDDIRQDPAIYPDASTRERLFAQKTQSPKDMRAITRVW
STVKTGF
Download sequence
Identical sequences B0KMN3
WP_012271838.1.81634 gi|167033194|ref|YP_001668425.1| 76869.PputGB1_2188

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]