SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 7719.ENSCINP00000013057 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  7719.ENSCINP00000013057
Domain Number 1 Region: 21-270
Classification Level Classification E-value
Superfamily Ribulose-phoshate binding barrel 3.81e-65
Family PdxS-like 0.0000000444
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 7719.ENSCINP00000013057
Sequence length 298
Comment (Ciona intestinalis)
Sequence
MAENHVTGSFTLKTGFAKMMKGGLIMDVINAEQAKIAEAAGACAVMALERVPADIRKMGG
VSRMSDPKMIKEIIAAVSIPVLAKVRIGHMAEAQILEALGVDMVDESEVLTMADEENHID
KHQFKTPFVCGARNLGEALRRISEGAAMIRTKGEAGTGNVVEAVRHARAISRQIRLAQAM
DASELYSFAKEIQAPVELLRETAKLGRLPVVNFAAGGLATPADVSMLMQLGVDGVFVGSG
IFKSNCPKKRADAMVQAVIHYKDPKTLAAISEDLGEAMVGINCEDLKEVWATREAKTN
Download sequence
Identical sequences A0A1W2W1I3
7719.ENSCINP00000013057 ENSCINP00000013057 ENSCINP00000013057 XP_002121070.1.78797 XP_009860474.1.78797

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]