SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 7719.ENSCINP00000019828 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  7719.ENSCINP00000019828
Domain Number 1 Region: 795-918
Classification Level Classification E-value
Superfamily cAMP-binding domain-like 2.75e-17
Family cAMP-binding domain 0.011
Further Details:      
 
Domain Number 2 Region: 538-646
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 0.0000000251
Family Voltage-gated potassium channels 0.027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 7719.ENSCINP00000019828
Sequence length 993
Comment (Ciona intestinalis)
Sequence
IREMDPELFLHVFLPVVIFESAYVIDHHVFWRSVFLLSVPGLLMATVLTAFLSLCIPEVA
NIGNFEVKVYVALIFGSIISATDPVAVVALLKDLGGQKYLGTIIEGEALLNDGAAIVVTI
RKKAHFRTNTIPNHQFILSLAWSTILLVVQQSLLGPLIGWLVARTGSFILQKIYNDALAE
ITVTLSLTYITFYVGEVCKTSGVLAVVTLGLALDRASITPQVDHFLHRFWEMLAYLANTL
IFVIVGIIIINHMEEITFLDVGHLLILYIGTTIIRAVSIFCFFPAMQRLGIDLNWRHVLV
MTWGGLRGAVGLTLAIYLNSYIGFGSVNHILMHTGGIVFLTLFINASTIEAVLKKLGMLD
ITNAQQVSMLNAVNRIQNDLKRSVGVLKYDRFLADAKWSMVEEMTMVEYPYKDLPTMMER
KRSSCRFVVSLKIKKINIFLLMLNLKLFSQMSYGKQYSTGMLTDQEARVLIAAADTAADK
PGEFINISVIRKSWEVTGILPHIKGKLEDWMYSRKTNSLVPPRNRQLRKIFRLVTGAKFE
IMMQCIIIINIVPIVLDFMVDETWENLTNGVFILIYCAEVGLKLAGLGNKQYIKSRWNQF
DVLILIICFVELIIDFVTTKVIKFGKVTKTIRMLRATRLLRLSKTIMPRMVDFINKLINK
KLSFGYNVGKGFITAEEEVNKLIVSISENSKIQAKLMEASDKNRLEVTREMGLLQRDHPG
IAISVKTKNAVSTILNHSRDAIHQLCAGGVLDENEMQLLERGIEIKLKRQTDFPSTVAPP
PPEDLLENVFWIKDNNDLLDYVKLNAVCMDYDYGDIIMQEDDLVDGIHIIVYGMIKLYGS
LHGHIQHLRLGSENHKPIEIGSKDFLGSGNIIGEIGLLTKCNRTCTITCETAVQTYFIST
EDMEKAFIQFPDLKQTMWKVVAIRISAPLFLENLEYQGFGLEQIHLHLSMGYIKEITPAN
PLIHFTDSIVEIALIHGSMKPIGTEEINAPFLF
Download sequence
Identical sequences 7719.ENSCINP00000019828

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]