SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 7739.JGI122200 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  7739.JGI122200
Domain Number 1 Region: 650-767
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 0.00000000000000863
Family Voltage-gated potassium channels 0.0083
Further Details:      
 
Domain Number 2 Region: 910-1028
Classification Level Classification E-value
Superfamily cAMP-binding domain-like 0.000000000000668
Family cAMP-binding domain 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 7739.JGI122200
Sequence length 1240
Comment (Branchiostoma floridae)
Sequence
MEFPLFEALGAGNASNSTNGTDSHGGGSGGHGDGDIHAHSGHHEQPYIILFLFASFALGA
LVRTLLKIVPGDLPYTVVLLVLGILLGLASARSPDFAHYTAIVHMNPHLLFHVFLPVLIF
ESAFAMDTHMFWKSIYQILIMALPGLLLASLLTGILSMYTFNYGWNWYVGMMFGSICSAT
DPVAVVALLKELGASKQLGTVIEGESLLNDGCGIVIFTMFLNLATGVEWAAADFVIFIVK
VMLGGPAFGFVMSKLTSFWLANIFNDALTEITITLASTYITFYVAEVLGVSGVLAVVILG
LTMERTSISPEVESFLHRFWEMMAYLANTVIFILVGVMIMEKSIHMIEGGDWFYIITLYF
GINVIRLIVIIILSPATSRVGYGLSWRYGVVTAWSGLRGAVGLAMALLVMQQEMTKGSSE
DWKMQVANKILIHIAGIVFLTLFINATTIKALLRLLGMSDISAPKRMTMYSAVRRVKDAQ
NRSFQVLKGDRFLADAEWTLVEKACEIQDPYKTKDEEVNAEEFVPFQRMSQCQDCKSMVP
NEPSPREYQDMAEEARLRTLKAQKVSYWKQFEHGMLNREAVRVLVQATESAADSVGEFVD
IEEIKKHWKIKGLLPRLRNKLEDLVTDKQKDQLPMPEHKFLRTVFIIVGHPAFEWSINVL
IILNLIPIIIEFTIEESDPQFSEYQFYLRITNYVFFVIYILEAVLKIIALRKHYFFSHWN
QFDLFIIAVSIIDIVLDNIFGNVDFNPAIFRIAKIFRLLRAMRMLRLSKAAIPRMINVID
NLINKQLSFGYDVGKGFVVGEEEVMKLIPTIIDNRSIARDLRQKSDISRRAVIRELGLLQ
RDHPGIAVSVKTRQSIRAVLNHSRDTIREMQGGGLLDETEAKKLEMVVEIKMKQLARAPP
SIPPPNPEQLLRHISWLEGNTELTEFMKARAKLLFHDFGSTLCKQSELPQGLFLIVSGMV
KLRGAGVKYTDYETQHSMDDDLEVYEDYLTSGNIIGEMGILNKQPRSTSVSCETSIQTYY
ISAEDMDMAFDLFSVNFLKERIWRVVAIRISTPLLLKTLAYQGWTHDKVRLRLETGYMPT
NLVDRRSFEIDQTMDDVILVQGHALSPHTAEEFVAPCIIPRTIHKLTFSTDSMEEGVLPP
QLLVVPNKEVIIEEDTKRRNSLYGGIGPSTTSLCLQHAAQRRSSHNLLAKKSSSSIFRRP
KSGKAKSVSIALPSLETASDGTTRRRTDLQPITDPAELTL
Download sequence
Identical sequences 7739.JGI122200

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]