SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 7739.JGI123132 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  7739.JGI123132
Domain Number 1 Region: 649-766
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 0.00000000000000753
Family Voltage-gated potassium channels 0.0099
Further Details:      
 
Domain Number 2 Region: 909-1027
Classification Level Classification E-value
Superfamily cAMP-binding domain-like 0.000000000000668
Family cAMP-binding domain 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 7739.JGI123132
Sequence length 1239
Comment (Branchiostoma floridae)
Sequence
MEFPLLEALGAGNASNSTNGTDSHGGGGGHGDGDIHAHSGHHEQPYIILFLFASFALGAL
VRTLLKIVPGDLPYTVVLLVLGILLGLASARSPDFAHYTAIVHMNPHLLFHVFLPVLIFE
SAFAMDTHMFWKSIYQILIMALPGLLLASLLTGILSMYTFNYGWNWYVGMMFGSICSATD
PVAVVALLKELGASKQLGTVIEGESLLNDGCGIVIFTMFLNLATGVEWAAADFVIFIVKV
MLGGPAFGFVMSKLTSFWLANIFNDALTEITITLASTYITFYVAEVLGVSGVLAVVILGL
TMERTSISPEVESFLHRFWEMMAYLANTVIFILVGVMIMEKSIHMIEGGDWFYIITLYFG
INVIRLIVIIILSPATSRVGYGLSWRYGVVTAWSGLRGAVGLAMALLVMQQEMTKGSSED
WKMQVANKILIHIAGIVFLTLFINATTIKALLRLLGMSDISAPKRMTMYSAVRRVKDAQN
RSFQVLKGDRFLADAEWTLVEKACEIQDPYKTKDEEVNAEEFVPFQRMSQCQDCKSMVPN
EPSPREYQDMAEEARLRTLKAQKVSYWKQFEHGMLNREAVRVLVQATESAADSVGEFVDI
EEIKKHWKIKGLLPRLRNKLEDLVTDKQKDQLPMPEHKFLRTVFIIVGHPAFEWSINVLI
ILNLIPIIIEFTIEESDPQFPEYQFYLRITNYVFFVIYILEAVLKIIALRKHYFFSHWNQ
FDLFIIAVSIIDIVLDNIFGNVDFNPAIFRIAKIFRLLRAMRMLRLSKAAIPRMINVIDN
LINKQLSFGYDVGKGFVVGEEEVMKLIPTIIDNRSIARDLRQKSDISRRAVIRELGLLQR
DHPGIAVSVKTRQSIRAVLNHSRDTIREMQGGGLLDETEAKKLEMVVEIKMKQLARAPPS
IPPPNPEQLLRHISWLEGNTELTEFMKARAKLLFHDFGSTLCKQSELPQGLFLIVSGMVK
LRGAGVKYTDYETQHSMDDDLEVYEDYLTSGNIIGEMGILNKQPRSTSVSCETSIQTYYI
SAEDMDMAFDLFSVNFLKERIWRVVAIRISTPLLLKTLAYQGWTHDKVRLRLETGYMPTN
LVDRRSFEIDQTMDDVILVQGHALSPHTAEEFVAPCIIPRTIHKLTFSTDSMEEGVLPPQ
LLVVPNKEVIIEEDTKRRNSLYGGIGPSTTSLCLQHAAQRRSSHNLLAKKSSSSIFRRPK
SGKAKSVSIALPSLETASDGTTRRRTDLQPITDPAELTL
Download sequence
Identical sequences C3Z1F9
7739.JGI123132 XP_002597565.1.56174

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]