SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 78245.Xaut_2831 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  78245.Xaut_2831
Domain Number 1 Region: 19-302
Classification Level Classification E-value
Superfamily FAD-linked oxidoreductase 1e-99
Family Methylenetetrahydrofolate reductase 0.0000000492
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 78245.Xaut_2831
Sequence length 317
Comment (Xanthobacter autotrophicus Py2)
Sequence
MTTPALAPAPAPVRASREMDRPPVKVSFEFFPPKSPEMEKTLWSSIARLAPLSPDFVSVT
YGAGGSTRERTHATVERIAKETDLAPAAHLTCVAATRDEIDAVVRAYGEAGVKHIVALRG
DPVTGVGTRYEPHPGGYAYANDLVAGIKRIGDFEVSVSAYPEKHPESASLDADIDVLKAK
VDAGATRAITQFFFENDVYFRYLDKVRARGIDIPIVPGILPVTNFKQASSFATRTGASVP
AWLLRRFEGLDDDVETRKLIAAAVAAEQVTDLVDRGVTDIHFYTLNRADLVYAICHLLGL
RPKVAGALADAPKAVAI
Download sequence
Identical sequences A7IJ78
78245.Xaut_2831 gi|154246770|ref|YP_001417728.1| WP_012114822.1.63109

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]