SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 78245.Xaut_3449 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  78245.Xaut_3449
Domain Number 1 Region: 576-1025
Classification Level Classification E-value
Superfamily ALDH-like 1.11e-118
Family ALDH-like 0.000000889
Further Details:      
 
Domain Number 2 Region: 198-543
Classification Level Classification E-value
Superfamily FAD-linked oxidoreductase 3.18e-116
Family Proline dehydrohenase domain of bifunctional PutA protein 0.000000000447
Further Details:      
 
Domain Number 3 Region: 30-197
Classification Level Classification E-value
Superfamily N-terminal domain of bifunctional PutA protein 1.27e-59
Family N-terminal domain of bifunctional PutA protein 0.00000241
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 78245.Xaut_3449
Sequence length 1221
Comment (Xanthobacter autotrophicus Py2)
Sequence
MIPAVAAPWAVPETAPLFAEFAPRSSPPLPLRAAFAAAHRRPERAAVADLLPAARLPPEL
RERIAARAGDLVTRLRARPRGSVVAALVQEYALSSQEGVALMCLAEALLRIPDSATRDAL
IRDKIGHGDWQAHLGGGRSLFVNAATWGLVLTGRLTATADDGRLSSALTRLVARCGEPLI
RRAVDMAIGLMGAEFVMGRTIEEALHRAGRREAQGFSYSFDMLGEAAMTAADAERYFAAY
AAAIEAIGKAAGGRGIHAGPGISVKLSALHPRYARAKAGRVMAELLPRLQRLALLARRHD
IGLNIDAEEQDRLELSLDLLEALAAHPGLAGWNGIGFVVQAYGKRCPAVLDFIIDLARRT
GRRIMVRLVKGAYWDAEIKRAQVDGMADFPVFTRKVHTDLCYIACARKLLAARDAVFPQF
ATHNAQTLAAIYELAGPDFRVGDYEFQCLHGMGEALYEEVVGPLTRPCRIYAPVGTHETL
LAYLVRRLLENGANSSFVHRLADDSVPLAELIADPAETVAAMADPGAPSPAIAAPRDLYG
SRANSAGLDLSSDAVLAALGETLAASRETPWRAQPAGGGGPARVVRNPGDHRDVVGEVRE
AGAEDVARAVAVARGAAPGWAARTPAERAAPLRAAADMLEAQMPHLLGLIMREAGKSAAN
AVAEVREAVDFLRYYADEATARLTAAHRPLGPVACISPWNFPLAIFTGQVAAALAAGNCV
LAKPAEETPLVAAEAVRLLHAAGIPQDVLQLLPGDGVVGAALVEAPEVAGVMFTGSTQVA
RAIAGVLACRLSPTGRPVPLIAETGGQNAMIVDSSALPEQVVADVLASAFDSAGQRCSAL
RVLCLQEEVADAMLAMLKGAMAELEIGRTDRLAVDVGPVITAEARAGIEGHVAAMAARGF
PIHRLPLPVEAANGTFVAPTLIEISSMADLTHEVFGPVLHVLRWRRADLGRLVDDINATG
YGLTFGLHTRLDETIAAVTGKVQAGNLYVNRNMIGAVVGVQPFGGHGLSGTGPKAGGPLY
LSRLVTGPAFALGAGTADHAALAFADWLDERGRADDGAAVRALAQVVPLGLSLDLPGPAG
ERNTWRLRPRGSLLLLPASERGLMRQIGMALATGNRAVVEAEAGLLSQLADLPPAVAARI
RTEGGDGPFAAALAEGEGARLVAVAQRLAALPGPIVPLHGATGEEIAASPFAFPAHLLLE
EVSLSVNSAAAGGNASLLAVA
Download sequence
Identical sequences A7IKY5
78245.Xaut_3449 WP_012115425.1.63109 gi|154247377|ref|YP_001418335.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]