SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 7955.ENSDARP00000064731 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  7955.ENSDARP00000064731
Domain Number 1 Region: 309-501
Classification Level Classification E-value
Superfamily cAMP-binding domain-like 3.67e-50
Family cAMP-binding domain 0.0000000172
Further Details:      
 
Domain Number 2 Region: 174-348
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 4.19e-16
Family Voltage-gated potassium channels 0.0088
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 7955.ENSDARP00000064731
Sequence length 589
Comment (Danio rerio)
Sequence
QRQFGAMLQPGVNKFSLRMFGSHKAVALEQERLKSAGSWIIHPYSDFRSHHQSTFIIIIV
LNLAFVEKSLVFTEESCQIKITLNVCKAVSTSKSRNLSTEHKHLNSSASLQLKPEDNNNY
YLKEKLVIIIIQLVIIIIIVIILNFQFLLDQESNKTFTLKIAAVWRLLMCCCLHTLLYTH
TRTHTHWMGIYPQVFTTAEVFITLLTVSGGACRILYQGSAGLLHYCISDLKHCPTTCRVM
TNKVGNDTWGVQYSYALFKAMSHMLCIGYGAQAPEGMTDVWLTMLSMIVGATCYAMFIGH
ATALIQSLDSSRRQYQEKYKQVEQYMSFHKLPADVRQKIHEYYEHRYQGKMFDEDNILGE
LSEPLKEEIVSFNCRSLVANMPLFANADPNFVTAVLTKLKFEVFQPNDFIIREGTVGRKM
YFIQHGRVSVLTRGNKETKLSDGSYFGDAEICLLTRGRRTASVRADTYCRLYSLSVDSFN
EVLEEHPMMRRAFETVAADRLDRIGKKNSILLRKTSQGGLGSCDSVLVQQIVKHDSMPTM
QDITVGPRGSTGGTVSPRPHPLIWAPLVHAPLQTAAATTNVAIALMHQQ
Download sequence
Identical sequences 7955.ENSDARP00000064731

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]