SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 7955.ENSDARP00000082937 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  7955.ENSDARP00000082937
Domain Number 1 Region: 53-455
Classification Level Classification E-value
Superfamily Ras GEF 6.15e-93
Family Ras GEF 0.0009
Further Details:      
 
Domain Number 2 Region: 524-586
Classification Level Classification E-value
Superfamily Cysteine-rich domain 2.54e-17
Family Protein kinase cysteine-rich domain (cys2, phorbol-binding domain) 0.0018
Further Details:      
 
Domain Number 3 Region: 453-524
Classification Level Classification E-value
Superfamily EF-hand 0.000000036
Family Calmodulin-like 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 7955.ENSDARP00000082937
Sequence length 687
Comment (Danio rerio)
Sequence
MGFDTMNRKESKSSRKSRQEGGIKSRRPVQRRMTCPSAQEISRALQSPPAHASFRSASLD
ELILRCLHCFDSDGKLNRGTQLVSMTLMMHNWVVPSHIFAHKLLSLYKDCPAEKRGQRRP
QICHFIRQWISQFRLMFEMDPLLEKAMGDLWALVSAEGTNSHHQLINTPYINPPVNISQT
PSPLVKKRKVSLLFDHMEPDEMAEHLSYLEFKNFCNVSFLDYRSYVVHGSVRDNPALERS
VMLCNGVSQWVQLMILNRHTSQQRAEVFTKFIHVAQKLRSLQNFNTLMAVIGGLCHSSIS
RLKDTASLLSSDVTKTLSELTELLSSYSNYSNYRRVYSECTGFKVPILGVHLKDLISLNE
ALPDYLEDDKINLGKLQHLYSNISDLLAIHDCTPPFEANKDLLHLLTLSLDLYYTEDEIY
ELSYAKEPKNPKIQPVAPVKPPVVAEWGSGVTPRLDPATISKHVKQMVDSIMKNYDLNMD
GYISLEEFEKIAANFPFSFCTHESDREGEISREEITSYFMRGMSVCAKLGFNLHNLHNFH
ETTYKRPTFCDTCGGFLWGVIKQGYHCKDCGVNCHKHCKDVVGMECLKRLQVNSSSCPCT
PGPVSGLHTKGNSWTFQSGSEEEAFVFPNGNESEHSKGQTSSDSDAEAATLSDRSTQTEP
GVWTPVAKRKDRLHSQKQHPPLEKVLP
Download sequence
Identical sequences Q1L9A0
ENSDARP00000082937 ENSDARP00000119563 NP_001038327.1.45394 7955.ENSDARP00000082937 ENSDARP00000082937

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]