SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 7955.ENSDARP00000095595 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  7955.ENSDARP00000095595
Domain Number 1 Region: 1-153
Classification Level Classification E-value
Superfamily Acyl-CoA N-acyltransferases (Nat) 4.32e-29
Family N-acetyl transferase, NAT 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 7955.ENSDARP00000095595
Sequence length 224
Comment (Danio rerio)
Sequence
MNIRNARPEDLMNMQHCNLLCLPENYQMKYYFYHGLSWPQLSYIAEDENGKIVGYVLAKM
EEDPDDVPHGHITSLAVKRSHRRLGLAQKLMDQASRAMIENFNAKYVSLHVRKSNRAALH
LYSNTLKFQISEVEPKYYADGEDAYAMKRNLTQMADELQKPGVRLWGSEAPPSQDTSVTG
LVEKLTVQDGEKEGDGDSGGESKEMSEVSEATESTDVKDSSSDS
Download sequence
Identical sequences Q7T3B8
7955.ENSDARP00000095595 7955.ENSDARP00000095601 NP_998499.1.45394 XP_018962492.1.5815 ENSDARP00000095601 ENSDARP00000095601

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]