SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 8090.ENSORLP00000005322 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  8090.ENSORLP00000005322
Domain Number 1 Region: 23-256
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 1.04e-77
Family Calponin-homology domain, CH-domain 0.000078
Further Details:      
 
Domain Number 2 Region: 1328-1443
Classification Level Classification E-value
Superfamily E set domains 1.53e-36
Family Filamin repeat (rod domain) 0.000014
Further Details:      
 
Domain Number 3 Region: 1040-1155
Classification Level Classification E-value
Superfamily E set domains 4.4e-36
Family Filamin repeat (rod domain) 0.00000377
Further Details:      
 
Domain Number 4 Region: 1517-1636
Classification Level Classification E-value
Superfamily E set domains 1.4e-33
Family Filamin repeat (rod domain) 0.00000712
Further Details:      
 
Domain Number 5 Region: 548-661
Classification Level Classification E-value
Superfamily E set domains 4.34e-31
Family Filamin repeat (rod domain) 0.000075
Further Details:      
 
Domain Number 6 Region: 461-567
Classification Level Classification E-value
Superfamily E set domains 6.01e-31
Family Filamin repeat (rod domain) 0.00095
Further Details:      
 
Domain Number 7 Region: 1442-1550
Classification Level Classification E-value
Superfamily E set domains 1.54e-30
Family Filamin repeat (rod domain) 0.0000265
Further Details:      
 
Domain Number 8 Region: 1824-1919
Classification Level Classification E-value
Superfamily E set domains 6.34e-30
Family Filamin repeat (rod domain) 0.0000077
Further Details:      
 
Domain Number 9 Region: 1239-1350
Classification Level Classification E-value
Superfamily E set domains 4.54e-29
Family Filamin repeat (rod domain) 0.000023
Further Details:      
 
Domain Number 10 Region: 661-762
Classification Level Classification E-value
Superfamily E set domains 1.08e-27
Family Filamin repeat (rod domain) 0.0006
Further Details:      
 
Domain Number 11 Region: 741-867
Classification Level Classification E-value
Superfamily E set domains 1.53e-27
Family Filamin repeat (rod domain) 0.0007
Further Details:      
 
Domain Number 12 Region: 2010-2103
Classification Level Classification E-value
Superfamily E set domains 2.5e-27
Family Filamin repeat (rod domain) 0.0000281
Further Details:      
 
Domain Number 13 Region: 1154-1262
Classification Level Classification E-value
Superfamily E set domains 3.14e-27
Family Filamin repeat (rod domain) 0.0000856
Further Details:      
 
Domain Number 14 Region: 2285-2375
Classification Level Classification E-value
Superfamily E set domains 6.67e-27
Family Filamin repeat (rod domain) 0.00000787
Further Details:      
 
Domain Number 15 Region: 274-368
Classification Level Classification E-value
Superfamily E set domains 5.4e-26
Family Filamin repeat (rod domain) 0.00084
Further Details:      
 
Domain Number 16 Region: 372-470
Classification Level Classification E-value
Superfamily E set domains 1.2e-25
Family Filamin repeat (rod domain) 0.00072
Further Details:      
 
Domain Number 17 Region: 856-966
Classification Level Classification E-value
Superfamily E set domains 1.33e-25
Family Filamin repeat (rod domain) 0.00075
Further Details:      
 
Domain Number 18 Region: 2476-2567
Classification Level Classification E-value
Superfamily E set domains 8.67e-25
Family Filamin repeat (rod domain) 0.0000084
Further Details:      
 
Domain Number 19 Region: 2613-2702
Classification Level Classification E-value
Superfamily E set domains 4.47e-24
Family Filamin repeat (rod domain) 0.0000118
Further Details:      
 
Domain Number 20 Region: 1625-1736
Classification Level Classification E-value
Superfamily E set domains 1.93e-22
Family Filamin repeat (rod domain) 0.0000673
Further Details:      
 
Domain Number 21 Region: 2218-2299
Classification Level Classification E-value
Superfamily E set domains 2e-21
Family Filamin repeat (rod domain) 0.00019
Further Details:      
 
Domain Number 22 Region: 952-1057
Classification Level Classification E-value
Superfamily E set domains 2.47e-21
Family Filamin repeat (rod domain) 0.00099
Further Details:      
 
Domain Number 23 Region: 2383-2472
Classification Level Classification E-value
Superfamily E set domains 4.4e-21
Family Filamin repeat (rod domain) 0.0000156
Further Details:      
 
Domain Number 24 Region: 1756-1840
Classification Level Classification E-value
Superfamily E set domains 1.27e-16
Family Filamin repeat (rod domain) 0.0000962
Further Details:      
 
Domain Number 25 Region: 1926-2006
Classification Level Classification E-value
Superfamily E set domains 3.67e-16
Family Filamin repeat (rod domain) 0.0000753
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 8090.ENSORLP00000005322
Sequence length 2704
Comment (Oryzias latipes)
Sequence
QLPPQYYQATDFGDEEEDEMPATEKDLAEDAPWKKIQQNTFTRWCNEHLKCVNKTITDLQ
KDFSDGLKLISLLEVLSQKKMYRKHHTRPNFRQMKLENVSVALEFLDREHIKLVSIDSKA
IVDGNLKLILGLIWTLILHYSISMPMWDDEDDEETKKLTPKQRLLGWIQNKVPQLPINNF
NRDWRDGKALGALVDNCAPGLCPDWVDWDPNQPVQNAKEAMQQADDWLGVPQVIAPEEIV
DPDVDEHSVMTYLSQFPKAKLKPGAPLRPKQLFPDKVKAYGPGIEPHGNKVLHPAVFTVE
TLEAGSGEVLVFVEDPEGHKEEAKVKPNKDKRGTYTVTYTPKVEGVHKVKVLFAGQDIDK
SPYTVNVDKDMGDPSKVHARGPGLEATGNVANKPTYFDIYTAGAGNGDISVVIVDPRGKK
DTVELILENKGDSVFRCTYHPVLEGPHTIHILFAGQEIPRSPFHVNIAEAINPNACRATG
RGLQPKGVRIREVADFKVFTKGAGSGTLNVSVKGPTGAEEQVKVRDAGNGVYECEYYPLK
AGKYTVSITWGGQPIPRSPFEVEVGEEAGFQKVRAWGPGLKTGMVGKSADFVVEAIGTEV
GTLGFSIEGPSQAKIECDDKGDGSCDVHYWPTEPGDYAVHVICDDEDIKDSPFMAHILPA
VNNVFPEKVKAYGPGLQPTGVIVNKPTEFTIDARMAGKGHLRIYAQDVEGCTIDIKITDR
GDGTFMCVYTPVKPIKHTIIITWGEVNVPNSPFRVLVGEGSHPDKVKVFGPGVEKTGLKA
NEPTYFTVDCSEAGQALGDISIGIKCAPGVVGPAEADIDFDIIKNDNDTFTVKYTPPAPG
RFTIMVLFADQEIPISPFKVKVDPSHDAGKVRAEGPGLNKTGVEVGTPTHFTIYTKGAGK
AKPEVHFAASGPGEAVRDFEIIDNHDYSYTVKYTALQQGNMAISIALGGDTIPKSPFHIT
VAPAMDLAKVKVEGLDTKVEVGKDQEFTVNTKGAGGLGNVGVKMTSPSGRPIPCKLESDK
AKGNHSVKYIPPEEGQYKVDVNYDGNPVLGSPFGVEAVMPADPSKVRAFGPGLQGGIVGK
PAPFTIDTKGAGAGGLGLTVEGPCEAKIECQDNGDGTCSVSYLPTEPGEYAINILFAEQH
ISGSPFKAAIRPALDPIKVVASGPGLERAKAGEPATFTVDCSRAGDAELTIEIVSETGVK
AEVHIQKTAEGTFSVTYIPSFQGTHTITIKYGGHTIPHFPRVLQVEPSVDTSGVHVYGPG
VEPRGVLREVTTHFIVDARALIKIGGGHVKVHIINPSGSNTDAYITDKGDGTYRVEYTAF
EDGIHLIEVLYDDAPVPKSPFRVSVVEGCDPTRVRAFGPGLEGGITNKPNRFTVETRGAG
TGGLGLTIEGASEAKISCKDNKDGSCSVEYVPFTPGDYDVNINYGGQPIPGSPFRVPVKD
PVDPTKVKCSGPGLGTGVRAHVPQNFTVDCTQAGQAPLDVKLYGPTGTVEPVGVKNNGDG
THTVHYTPAQDGPYTVSVKYSDQEVPHSPFKVMSQPGHDASKVRASGPGLDIKGVPASLP
VEFTIDARDAGEGLLTVQILDPEGKPKNATIQDNRDGTYTVSYVPDSTGPYTITIKYGGD
EIPYSPYRIQSLPTGDASKCLLTVSVGGHGMSSLQKLQTSEDTVITVDAKAAGKGKVTCK
VLTPQGMELDMDVVENRDGTFDIYYTAPEPGKYVITIRFGGQNIPKSPFQVMVSKGATNE
PVVPRDTVDPLFRPVNFLVPFTPQQGEITGEVKMPSGKTARPHITDNKDGTITIKYQPTE
RGLHEMDIKYDGNHIPGSPLQFYVDAVNSGVVTAYGPGLSYGMVNKSATFTVVTKNAGEG
GLSLAVEGPSKAEITCKDNKDGTCTVSYLPTAPGDYNIIVKFDNKHIPGSPFTAKITGDD
SITRTSQLNVGTATDVSLKITETDLSCLTASIRAPSGNEEPCLLKRLPNRHLGISFTPKE
VGEHEVSVRKDGIHVANSPFKIMVGQSEIGEASRVKAFGKGLIEAHTFEMAEFFVDTRNA
GYGGLALSIEGPSKVDINCEDMEDGTCRVTYCPTEPGSYTVNIKFAEKHIPGSPFAVKVT
GEGRIKESITRKRQASSLASVGSTCGLNLKIPGNWFQMVSAQERLTRTFTRSSHTYTRTE
RTEISKTRGGETKREVRVEESTQVGGGGSPFRDVFGDFLGRESLSSFAGLTARPEVESGS
QAMTAQVTSPSGKTVDADIVDGGSSTYSVRFIPQEIGPHTVNVKYRGQHVPGSPFQFTVG
PMGEGGAHKVRAGGPGLERGVAGAPSEFSIWTREAGAGGLSIAVEGPSKAEITFEDRKDG
SCGVSYIVKEPGDYEVSIKFNNEHIPDSPFIVPIATLSDEARRLTVTSLQEKDLKVNQEA
SFMVQRNGPRGVVDAKVHTPSGSTEECYVSELDSDKSAIRFIPRENGVHSIDVKFNGCHI
PGSPFNVRVGDPGLIGDPGMVTAHGPGLQGGTTGIPSEFVVKTCNAGSGTLSVNIDGPSK
VKMDCRECPEGYRITYTPMAPGNYLITIKYGGPQHIVGSPFKAKVTGTRLSGGHSLHETS
SVLVETVTKTSKVGGAYSASSSSSTTSTKLTSDASKVVCRGQGLSKAVVGQKNNFSVDCS
KAGTNMLMVGVHGPHAPCEEVYVKHMGNKLYNVTYTVKDKGSYTVIVKWGDDNVPGSPYK
VSAP
Download sequence
Identical sequences H2LH67
ENSORLP00000005322 ENSORLP00000005322 8090.ENSORLP00000005322

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]