SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 81824.JGI33636 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  81824.JGI33636
Domain Number 1 Region: 2-262
Classification Level Classification E-value
Superfamily Subunits of heterodimeric actin filament capping protein Capz 2.49e-89
Family Capz beta-1 subunit 0.00000000474
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 81824.JGI33636
Sequence length 274
Comment (Monosiga brevicollis)
Sequence
MSDQQLDCALDLMRRLPPQKIEENLTGLIDLVPSLCEDLLSSIDQPLKRATDPESGRHYL
LCDYNRDGDSYRSPWSNQYYPAMDDGVVPSPELRELEIQANNAFDSYRDLYYEGGASSVY
LWDTEEDGFAGVVLIKKIGDGSKKIKGCWDSIHVFQVLEKSNGRNATYQLTSTVMLWLET
NKDGSGLMQLGGSLTRQAEQDCTVDDNNPHIANIGRMIEDMENQMRSVLNQIYFGKTKDI
VNDLRSVKSLKEAQSHMQMQKDIAAALTLRNKKN
Download sequence
Identical sequences A9V6Q7
XP_001748321.1.20067 81824.JGI33636 jgi|Monbr1|33636|estExt_fgenesh2_pg.C_220060

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]