SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 882.DVU1431 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  882.DVU1431
Domain Number 1 Region: 9-131
Classification Level Classification E-value
Superfamily Histidine-containing phosphotransfer domain, HPT domain 0.0000000000000206
Family Chemotaxis protein CheA P1 domain 0.0053
Further Details:      
 
Domain Number 2 Region: 623-714
Classification Level Classification E-value
Superfamily SpoIIaa-like 0.0000000000153
Family Anti-sigma factor antagonist SpoIIaa 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 882.DVU1431
Sequence length 731
Comment (Desulfovibrio vulgaris Hildenborough)
Sequence
MTDQEKRTQLEREFLGEALRVLADAGVDLLELEVGGDGVEHAVLGRLSRITQTMRGGAGL
LGLNAMHELALVLEAVLDLARHEKLPLDTVVITAIERGMDAFAARFKGMRDSQDAGGTAG
RAEVTQAVQLLQGVVRQPADARCISERHVVRGPDVDAVFTMGGHDLRRASREGLRFYVLA
FDVEHDLRQKDVSPLGLLVFLQKSGDVVDARFTGVRGGGGGNVGVLFSSILDADLLGAVF
QIDASRVFAVDTDAVARGEAAWRERDLPAPDAGKSAMPDEPDSRSIELLLLQYDEAMKRL
REQSMQDDFEPYDMNSDTDEKPASQNAGGEFDEVVGMPDTSFDGQEAMPLSGTLSDTVAD
PVYQAAGAEAEEYATDAPSSGMAGDAMPPLDAPGSYGFFDDAPGVGILTDTPHPVADTLE
TGEASGSLAGDDAVDDDAAASLLLDLEAEFDAPLLDEADAYAVEPHRIGLAEGGTLDGAA
SHLSDGLSIADSDLDFFRDDAPPPDQSHLDLPLSERGEKPGGDGIMLDLGFDDAAGDEAP
AVDTFPEAPAMPAAAGMGLDASLVDPDVMAAVGAAGGLPPHDEAIAEAVAFPAGTPSATA
SVPSSPRPVSGTGVAAEPTSGGFDVRESGGSGILILSGELTIERSLAFRDALLEMFDRYQ
NVRLDLSGVTEVDLTFFQLLRAAVVTAQRRGGTLAGCGVVPAPVSETAHRAGLDAQAVKR
AGFEAVLGGMA
Download sequence
Identical sequences A0A0E0T389 Q72C53
gi|46579842|ref|YP_010650.1| gi|387153709|ref|YP_005702645.1| 882.DVU1431 WP_010938724.1.14085 YP_010650.1.77684

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]