SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 9031.ENSGALP00000007930 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  9031.ENSGALP00000007930
Domain Number 1 Region: 27-165
Classification Level Classification E-value
Superfamily dUTPase-like 2.36e-49
Family dUTPase-like 0.000000232
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 9031.ENSGALP00000007930
Sequence length 166
Comment (Gallus gallus)
Sequence
MPCSEAALQPSPSKRQKGSAAGEPSARLRFTKLSENACAPSKGSARAAGYDLYSAYDYVI
PPMEKAVVKTDIQIALPAGCYGRVAPRSGLAAKHFIDVGAGVIDEDYRGNVGVVLFNFGK
ETFEVKKGDRIAQLICERIFYPELEEVQALDDTERGEGGFGSTGKN
Download sequence
Identical sequences Q5ZKJ3
NP_001072956.1.86415 XP_015147417.1.86415 9031.ENSGALP00000007930 ENSGALP00000007930 ENSGALP00000007930

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]