SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 9258.ENSOANP00000001428 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  9258.ENSOANP00000001428
Domain Number 1 Region: 864-984
Classification Level Classification E-value
Superfamily cAMP-binding domain-like 0.00000000000589
Family cAMP-binding domain 0.034
Further Details:      
 
Domain Number 2 Region: 602-714
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 0.00000196
Family Voltage-gated potassium channels 0.023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 9258.ENSOANP00000001428
Sequence length 1079
Comment (Ornithorhynchus anatinus)
Sequence
MIEYFNESNSYKLICGRYIKVPEESHVLLLMLSIIAVAGLLRAFLKHTRVPILAVLLIFG
FIVGQVGRQYKEVSMVIYPILATNNYALFHFFTPLIIFMAAMDMDFYILKKLFWQVAMLG
CSNFFMTFILIGYFTLEYNKYKWELGSCLLFGVVLGITDPLLAVRPLKNLGVPKMLIDLI
RGEALASYGIASVILGILKTMELQSPVPKEMHILLHLCHDIFGSILFGFWCSKIVQYLLS
DIFSDTVADVNVCFSMTYFIFYVAEWLGMSGVVSIMTLGLLLDSISFRPGIDVIVIRFLI
LLTFLCQAFICSIIGIILGCEDLSYLKFHSGFFTILTYFILSLVRVLTILLVSPLLMNSG
FGFNWRWGCVIVCSGIKGSLCLISAPAFNDMIMPMKSPPQAFLAHIVAATILTMVLNSEL
SIRSSVVLGLCVVSIPRQMAVHNAIRHIGEMVDNTIALSKTEKILTNVIWTKVEEITKIE
YPVQNLGEEDMSNIEEDLLEEARMHVSIIQMSSFEKQCKDGNLNEEAARILIGASKSYSA
TKGKFMSIHDVSTYVKTKSVLMRVKNLLLYLVYSNEREKFTPPKSKFAFLAYHIVFSDEF
EYAGHILSLLYVYPMMMHLLPVVRAINVIGLIIVNYYFVLLYITEAVLKIAVMKRKYFSY
SWNQMELFIIVHGLVDIFFVHFVTLIGEDPVIVQITTVLEYFRFFRFLRIFKMILPTLIE
LIEAQIKKRLSLMYSLTKGYIRSQEDIKRLIRQIAGQEPVSQKLYEILEKNKEEAIKELG
LIEHECRDVVIALKTKQAIRSVLGKALKNLRFLRSRGIIDKIEGTKMNKIFLSKIKELNH
FPTVIPPPTPEKFLHHIVWLEDKDVLIEFFKEKAHLACFDGAVICKEGEMPQGIYLIISG
MASLHGTRLKFGIDPQVYHNPENTKMSFTDYCTSGDIIGELSCLLKQELEFTATCETILQ
ACFISLEDLYEGFDVFWPFLEYKMWLKIALNIASQYFEEYLASEELAYQKVVEFNNIYVE
TLLSYNELTIYDNTMEHVFVVHGSVIDVHTEAPYYAPCLIPKNCTQIQGTSPRDLEKLV
Download sequence
Identical sequences F6RBA9
ENSOANP00000001428 ENSOANP00000001428 9258.ENSOANP00000001428

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]