SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 9361.ENSDNOP00000007487 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  9361.ENSDNOP00000007487
Domain Number 1 Region: 404-595
Classification Level Classification E-value
Superfamily cAMP-binding domain-like 5.89e-49
Family cAMP-binding domain 0.0001
Further Details:      
 
Domain Number 2 Region: 353-402
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 0.000000124
Family Voltage-gated potassium channels 0.0063
Further Details:      
 
Weak hits

Sequence:  9361.ENSDNOP00000007487
Domain Number - Region: 616-662
Classification Level Classification E-value
Superfamily Tropomyosin 0.036
Family Tropomyosin 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 9361.ENSDNOP00000007487
Sequence length 689
Comment (Dasypus novemcinctus)
Sequence
KLIMKTNVINTQHSFVYIPNVIVLDTEKEIRRMENGACSSFSDNDDSTSIFEESESENPY
ARDSFRHSSHGRRGPSQXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXEKKEVMVIDPSGNIYYNWLFCITLPVMYNWT
MIIAXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXYWSTLTLT
TIGETPPVRDSEYVFVVADFLIGVLIFATIVGNIGSMISNMNAARAEFQARIDAIKQYMH
FRNVSKDMEKRVIKWFDYLWTNKKTVDEKEVLKYLPDKLRAEIAINVHLDTLKKVRIFAD
CEAGLLVELVLKLQPQVYSPGDYICKKGDIGREMYIIKEGKLAVVADDGITQFVVLSDGS
YFGEISILNIKGSKAGNRRTANIKSIGYSDLFCLSKDDLMEALTEYPDAKAMLEEKGKQI
LMKDGLLDINIANAGSDPKDLEEKVIRMEGSVDRLQTRFAQILAEYESMQQKLKQRLTKV
EKFLKPFTDVEFSAIEGSEGESAPKDSTQ
Download sequence
Identical sequences ENSDNOP00000007487 9361.ENSDNOP00000007487

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]