SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 9544.ENSMMUP00000000806 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  9544.ENSMMUP00000000806
Domain Number 1 Region: 121-339,385-475
Classification Level Classification E-value
Superfamily Quinoprotein alcohol dehydrogenase-like 0.000000000051
Family Quinoprotein alcohol dehydrogenase-like 0.0084
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 9544.ENSMMUP00000000806
Sequence length 639
Comment (Macaca mulatta)
Sequence
IWEPSQSGAQCWLRWVHLGLRRHRFPVHSSQPDAPAGVNIEHVLRAAPPLGTPTTRSVPV
MLDHQDLEAEVHPLKNEERKSQENLGNPSKNEDKLKSTPPQSRLSRCRTVAFFLSLFLCL
FVVFVVSFVIPCPDRPASQRMWRIDYNAAVIYDFLAVDDINGDRIQDVLFLYKNTNSSNN
FNRSCVDEGFSSPCAFAAAVSGANGSTLWERPVAQDVALVECAVPQPRGSEAPSACILVG
RPGSFIAVDSFTGETLWNHSSSFSRNASILSPLLQVPDVDSDGAPDLLVFTQEQEEVSGH
LYSGSTGHQIGLRGGLGVDGESGFLLHVTRTGAHYILFPCASSLCGCSVKGLYEKVTGRD
GPFKNDPHWESMLNATTRRMLSHSSGAVRYLMHVPGNTGADVLLVGSEGFVLLDGQELTP
RWTPKAAHVLRKPIFGHYKPDTLAVVVENGTGTNRQILFLDLGTGAVLCSLALPSLPGGP
LSASLPTADHRSAFFFWGLHELGSTSETETGEARHSLYMFHPTLPRVLLELANVSTHIVA
FDAVLFEPSRHAAYILLTGPADSEAPGLVSVIKHKVRDLVPSSRVVHLGEGEPDSDQAIR
DRFSRLRSQGVMELRPQGLNGNLRQLQLPSPSRSCRGIL
Download sequence
Identical sequences ENSMMUP00000000805 ENSMMUP00000000806 9544.ENSMMUP00000000806

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]