SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 9544.ENSMMUP00000001925 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  9544.ENSMMUP00000001925
Domain Number 1 Region: 3-134
Classification Level Classification E-value
Superfamily Histone-fold 1.93e-57
Family Nucleosome core histones 0.000000624
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 9544.ENSMMUP00000001925
Sequence length 137
Comment (Macaca mulatta)
Sequence
TMARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKST
ELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEACEAYLVGLFEDTNLCAIHAKRVT
IMPKDIQLARRIRGERA
Download sequence
Identical sequences ENSMMUP00000001925 ENSPTRP00000030454 ENSMMUP00000001925 ENSPTRP00000030454 9544.ENSMMUP00000001925

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]