SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 9544.ENSMMUP00000004821 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  9544.ENSMMUP00000004821
Domain Number 1 Region: 398-615
Classification Level Classification E-value
Superfamily YWTD domain 1.02e-42
Family YWTD domain 0.00000000156
Further Details:      
 
Domain Number 2 Region: 282-394,662-707
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000000204
Family Growth factor receptor domain 0.014
Further Details:      
 
Domain Number 3 Region: 142-184
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000000314
Family LDL receptor-like module 0.00012
Further Details:      
 
Domain Number 4 Region: 104-144
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000000772
Family LDL receptor-like module 0.00012
Further Details:      
 
Domain Number 5 Region: 26-70
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000000982
Family LDL receptor-like module 0.00012
Further Details:      
 
Domain Number 6 Region: 196-232
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000196
Family LDL receptor-like module 0.00016
Further Details:      
 
Domain Number 7 Region: 230-271
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000196
Family LDL receptor-like module 0.00014
Further Details:      
 
Domain Number 8 Region: 62-104
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000367
Family LDL receptor-like module 0.00015
Further Details:      
 
Domain Number 9 Region: 274-311
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000707
Family LDL receptor-like module 0.00012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 9544.ENSMMUP00000004821
Sequence length 856
Comment (Macaca mulatta)
Sequence
MGPWGWKLRWTVAFLLAAAEAAVGDRCERNEFQCEDGKCISYKWVCDGTAECQDGSDESQ
ETCLSVTCKSGDFSCGGRVNRCIPQFWRCDGEVDCENGSDEQDCPPKTCSQDEFRCHDGK
CIYRQFVCDSDRDCLDGSDEASCPVLTCGPASFQCNSSTCIPQLWACDNDPDCEDGSDEW
PQHCQGLEVPKRDSSPCSAFEFHCRSGECIHSGWRCDGGPDCKDKSDEENCPVATCRPDE
FQCSDGTCIHGSRQCDREYDCKDMSDEVGCINVTLCEGPNKFKCHSGECISLDKVCNMAR
DCRDWSDEPIKECGTNECLDNNGGCSHICNDLKIGYECLCPDGFQLVAQRRCEDIDECQD
PDTCSQLCVNLEGSYKCQCEEGFQLDPHTKACKAVGSIAYLIFTNRHEVRKMTLDRSEYT
SLIPNLRNVVALDTEVASNRIYWSDLSQRMIYSTQLDRAHSVSSYDTVISRDLQAPDGLA
VDWIHSNIYWTDSVLGTVSVADTKGVKRKTLFRENGSKPRAIVVDPVHGFMYWTDWGTPA
KIKKGGLNGVDIYSLVTENIEWPNGITLDFPSGRLYWVDSKLHSISSIDVNGGNRKTILE
DKERLAHPFSLAIFEVRLTWQIDTDCVDHSSQDECGKLVMTRRSLSDDLVPDSTSSAPGV
NWCERTTLSNGGCQYLCLPAPQINPQSPKFTCTCPDGMLLAKDMRSCLTEAEAAVATQET
STVRLMVSSKAVATQHTTTRPVPNTSQLPGATPGLTTAETVTMSHQALGDVAGRGNEKKP
KSVGALSIVLPTVLLVFLCLGAFLLWKNWRLKSINSINFDNPVYQKTTEDEVHICRNQDG
YSYPSRQMVSLEDDVA
Download sequence
Identical sequences 9544.ENSMMUP00000004821 ENSMMUP00000004819 ENSMMUP00000004821

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]