SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 9544.ENSMMUP00000006856 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  9544.ENSMMUP00000006856
Domain Number 1 Region: 521-705
Classification Level Classification E-value
Superfamily cAMP-binding domain-like 1.31e-44
Family cAMP-binding domain 0.00033
Further Details:      
 
Domain Number 2 Region: 251-426,456-517
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 7.85e-44
Family Voltage-gated potassium channels 0.0025
Further Details:      
 
Domain Number 3 Region: 38-131
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 4.89e-19
Family Flavin-binding PAS domain 0.0000206
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 9544.ENSMMUP00000006856
Sequence length 994
Comment (Macaca mulatta)
Sequence
MPVRRGHVAPQNTYLDTIIRKFEGQSRKFLIANAQMENCAIIYCNDGFCELFGYSRVEVM
QQPCTCDFLTGPNTPSSAVSRLAQALLGAEECKVDILYYRKDASSFRCLVDVVPVKNEDG
AVIMFILNFEDLAQLLAKRSSRSLSQRLLSQSFLGSEGSHGRPGGPGPGTGRGKYRTISQ
IPQFTLNFVEFNLEKHRSSSTTEIEIIAPHKVVERTQNVTEKVTQVLSLGADVLPEYKLQ
APRIHRWTILHYSPFKAVWDWLILLLVIYTAVFTPYSAAFLLSDQDESRRGACGYTCSPL
TVVDLIVDIMFVVDIVINFRTTYVNTNDEVVSHPRRIAVHYFKGWFLIDMVAAIPFDLLI
FRTGSDETTTLIGLLKTARLLRLVRVARKLDRYSEYGAAVLFLLMCTFALIAHWLACIWY
AIGNVERPYLEHKIGWLDSLGVQLGKRYNGSDPASGPSVQDKYVTALYFTFSSLTSVGFG
NVSPNTNSEKVFSICVMLIGSLMYASIFGNVSAIIQRLYSGTARYHTQMLRVKEFIRFHQ
IPNPLRQRLEEYFQHAWSYTNGIDMNAVLKGFPECLQADICLHLHRALLQHCPAFSGASK
GCLRALAVKFKTTHAPPGDTLVHLGDVLSTLYFISRGSIEILRDDVVVAILGKNDIFGEP
VSLHARPGKSSADVRALTYCDLHKIQRADLLEVLDMYPAFADSFWSKLEVTFNLRDAAGG
LHSSPRQAPGSQDHQGFFLNDNQSGSPHELGPQFPSKGYHLLGPGNQNSMGAGACAPGHP
DAAPPLSISDASGLWPELLQKMPPRHSPPTPQGDPDCWPLKLGSRLEQLQAQMNRLESRV
SSDLSRILQLLQQPMPQGQATYILEAPASNDLALFPIASEMTSPGPRLPQGFLPPAQTPS
YGDLDDCSAKHRSSSPRMPHLAVATDKTLAPSSEEEQPEGLWAPLASPLYPLKVQGLICG
PCFSSLPEHLGSVPKQLDFQRHGSDPGFAGSWGH
Download sequence
Identical sequences ENSMMUP00000006856 XP_001116131.1.72884 ENSMMUP00000006856 9544.ENSMMUP00000006856

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]