SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 9544.ENSMMUP00000009704 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  9544.ENSMMUP00000009704
Domain Number 1 Region: 151-246
Classification Level Classification E-value
Superfamily S13-like H2TH domain 7.46e-22
Family Middle domain of MutM-like DNA repair proteins 0.013
Further Details:      
 
Domain Number 2 Region: 48-109
Classification Level Classification E-value
Superfamily N-terminal domain of MutM-like DNA repair proteins 0.000000419
Family N-terminal domain of MutM-like DNA repair proteins 0.011
Further Details:      
 
Domain Number 3 Region: 314-341
Classification Level Classification E-value
Superfamily Ran binding protein zinc finger-like 0.00001
Family Ran binding protein zinc finger-like 0.0045
Further Details:      
 
Weak hits

Sequence:  9544.ENSMMUP00000009704
Domain Number - Region: 241-278
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.0855
Family C-terminal, Zn-finger domain of MutM-like DNA repair proteins 0.024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 9544.ENSMMUP00000009704
Sequence length 602
Comment (Macaca mulatta)
Sequence
MVEGPGCTLNGEKIRARVLPGQAVTGVRGSALRSLQGRALPLAASTAVVSPQASALNNND
ASSLFNGYVYSGVETLGKELFMYFGPKAFRIHFGMKGSIMINPLECKYKNGASPVLEVQL
TKDLICFFDSSVELRNSMESQRRVGMMKELDVCSPEFSFLRAENEVKKQKGRMLGDVLMD
QNVLPGVGNIIKNEALFDSGLHPAVKVCQLTDEQTHHLVKMIRDFSILFYRCRKAGLAVS
KHYKVYKRPNCGQCHCRITVCRFGDNNRMTYFCPRCQKENPQHVDICRLPTRNTIISWTS
SRVDHVMDSVARKSEEQWTCVVCTLINKPSSKACDACLTSRPIDSMLKNEENSTVFSHLM
KYPCNTFGKPHTEVKINRKTAFGTTTLVLTDFSNKSSTLEIKKKQNQTLDKEFQNSPPTN
VCLKDTQHPSKKRTNNITQLSSKVNIAPTISSESKLFSPAHKKLKTAHCSSPDLKSCNPG
YSSSELQINVTDGPRTLNPDGPRCSKHSRLCVLRVVRKDGENKGRQFYACPLPREAQCGF
FEWADLSFPFCNHGKRSIMKTVLKIGPNNGKNFFVCPLGKEKQCNFFQWAENGPGMKIIP
GC
Download sequence
Identical sequences F6T3Q0
ENSMMUP00000009704 9544.ENSMMUP00000009704 ENSMMUP00000009704 XP_001090459.1.72884

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]